Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6F5G2

Protein Details
Accession A0A5N6F5G2    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
41-60GTGIEKWRKKKNRGTTSTSIHydrophilic
NLS Segment(s)
PositionSequence
8-16RRWKKLGKS
Subcellular Location(s) mito 12.5, mito_nucl 10.833, nucl 8, cyto_nucl 6.833, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MANINRERRWKKLGKSRSEEGVKRAVHSVGPWTVTLLTLWGTGIEKWRKKKNRGTTSTSILVTRAEKPTVWRLQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.78
3 0.76
4 0.76
5 0.75
6 0.68
7 0.61
8 0.59
9 0.49
10 0.43
11 0.4
12 0.31
13 0.24
14 0.21
15 0.21
16 0.15
17 0.15
18 0.14
19 0.12
20 0.12
21 0.11
22 0.11
23 0.07
24 0.06
25 0.05
26 0.05
27 0.05
28 0.05
29 0.05
30 0.13
31 0.2
32 0.25
33 0.32
34 0.42
35 0.51
36 0.59
37 0.68
38 0.73
39 0.77
40 0.78
41 0.8
42 0.76
43 0.74
44 0.7
45 0.61
46 0.5
47 0.4
48 0.35
49 0.29
50 0.27
51 0.25
52 0.22
53 0.22
54 0.27
55 0.35