Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6EYY8

Protein Details
Accession A0A5N6EYY8    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
68-99QAKSRKYGYARPRNRIRRRPSPRRSSPLALRSHydrophilic
NLS Segment(s)
PositionSequence
72-92RKYGYARPRNRIRRRPSPRRS
Subcellular Location(s) plas 10, mito 7, extr 3, E.R. 3, nucl 1, cyto 1, cyto_nucl 1, pero 1, golg 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MFVYFILILFFQTLGLFPRHSRVREFSSHPRHLLRMTSPNWGPRLALMRLSGIERSTSKGLVVTTTIQAKSRKYGYARPRNRIRRRPSPRRSSPLALRSITCKILTYRLIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.12
4 0.12
5 0.2
6 0.25
7 0.27
8 0.31
9 0.34
10 0.38
11 0.42
12 0.49
13 0.52
14 0.56
15 0.59
16 0.58
17 0.54
18 0.51
19 0.47
20 0.43
21 0.37
22 0.35
23 0.32
24 0.35
25 0.35
26 0.36
27 0.36
28 0.33
29 0.28
30 0.22
31 0.25
32 0.19
33 0.19
34 0.16
35 0.15
36 0.15
37 0.16
38 0.15
39 0.1
40 0.11
41 0.09
42 0.11
43 0.12
44 0.11
45 0.1
46 0.11
47 0.1
48 0.09
49 0.1
50 0.09
51 0.1
52 0.12
53 0.13
54 0.16
55 0.18
56 0.19
57 0.22
58 0.23
59 0.26
60 0.27
61 0.35
62 0.42
63 0.51
64 0.58
65 0.64
66 0.72
67 0.78
68 0.85
69 0.87
70 0.85
71 0.85
72 0.88
73 0.9
74 0.9
75 0.9
76 0.89
77 0.87
78 0.85
79 0.82
80 0.8
81 0.77
82 0.73
83 0.64
84 0.55
85 0.52
86 0.49
87 0.43
88 0.35
89 0.3
90 0.26
91 0.3