Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179V0Z7

Protein Details
Accession A0A179V0Z7    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
61-80FKMIIISDEKKKKKKKKNKKBasic
NLS Segment(s)
PositionSequence
69-80EKKKKKKKKNKK
Subcellular Location(s) nucl 15.5, cyto_nucl 13, cyto 9.5
Family & Domain DBs
Amino Acid Sequences MHFLIQNIEKTALLSEHANLLITEIEPETADQKMQDFEIQIDLAKRKQQKPFSEKIVKRDFKMIIISDEKKKKKKKKNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.12
4 0.12
5 0.12
6 0.1
7 0.1
8 0.09
9 0.08
10 0.08
11 0.06
12 0.07
13 0.06
14 0.07
15 0.07
16 0.07
17 0.07
18 0.06
19 0.07
20 0.07
21 0.08
22 0.08
23 0.07
24 0.07
25 0.08
26 0.08
27 0.08
28 0.09
29 0.1
30 0.1
31 0.15
32 0.22
33 0.26
34 0.34
35 0.42
36 0.5
37 0.56
38 0.61
39 0.66
40 0.7
41 0.67
42 0.68
43 0.71
44 0.65
45 0.59
46 0.59
47 0.51
48 0.43
49 0.44
50 0.37
51 0.31
52 0.35
53 0.38
54 0.41
55 0.49
56 0.56
57 0.61
58 0.7
59 0.75
60 0.8