Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UKD8

Protein Details
Accession A0A179UKD8    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
11-48RGGLNKEQKRKQTDRQTDKEEGVKNRRKRKRIDYQITDBasic
NLS Segment(s)
PositionSequence
31-41EGVKNRRKRKR
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MRCSQVEELGRGGLNKEQKRKQTDRQTDKEEGVKNRRKRKRIDYQITDTILICTGVTGCDALIYRAYSMSSPQPCQNLHDMTCRERRRITGSTGLKEKRVVGIC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.31
3 0.39
4 0.44
5 0.52
6 0.61
7 0.67
8 0.73
9 0.75
10 0.79
11 0.8
12 0.81
13 0.8
14 0.74
15 0.69
16 0.66
17 0.61
18 0.58
19 0.58
20 0.59
21 0.6
22 0.67
23 0.73
24 0.73
25 0.76
26 0.78
27 0.79
28 0.81
29 0.83
30 0.8
31 0.78
32 0.76
33 0.69
34 0.59
35 0.48
36 0.37
37 0.26
38 0.19
39 0.11
40 0.06
41 0.05
42 0.04
43 0.04
44 0.03
45 0.03
46 0.04
47 0.04
48 0.05
49 0.06
50 0.06
51 0.06
52 0.07
53 0.07
54 0.07
55 0.09
56 0.15
57 0.17
58 0.19
59 0.22
60 0.26
61 0.26
62 0.29
63 0.33
64 0.3
65 0.29
66 0.35
67 0.35
68 0.37
69 0.46
70 0.47
71 0.46
72 0.45
73 0.47
74 0.46
75 0.47
76 0.47
77 0.48
78 0.51
79 0.54
80 0.6
81 0.59
82 0.54
83 0.52
84 0.48