Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6ETA2

Protein Details
Accession A0A5N6ETA2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
38-63RLLVRPRREQKSREKEKKKETQCAASHydrophilic
NLS Segment(s)
PositionSequence
42-56RPRREQKSREKEKKK
Subcellular Location(s) mito 6, extr 5, E.R. 5, cyto 4.5, cyto_nucl 3.5, plas 2, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVILGCLVQNYSHLCGPIFPFFLVLFFLALTVFLSLPRLLVRPRREQKSREKEKKKETQCAASQPNGKIIDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.19
4 0.2
5 0.19
6 0.16
7 0.16
8 0.15
9 0.15
10 0.14
11 0.11
12 0.08
13 0.06
14 0.06
15 0.05
16 0.05
17 0.05
18 0.04
19 0.04
20 0.04
21 0.05
22 0.05
23 0.05
24 0.06
25 0.07
26 0.09
27 0.17
28 0.22
29 0.31
30 0.4
31 0.48
32 0.53
33 0.59
34 0.67
35 0.72
36 0.78
37 0.78
38 0.81
39 0.82
40 0.86
41 0.9
42 0.87
43 0.86
44 0.81
45 0.79
46 0.75
47 0.75
48 0.7
49 0.67
50 0.65
51 0.57
52 0.58