Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q756I3

Protein Details
Accession Q756I3    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
152-172IPAFIYKVKNSKKKFRMEFRSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024145  His_deAcase_SAP30/SAP30L  
IPR038291  SAP30_C_sf  
IPR025718  SAP30_Sin3-bd  
Gene Ontology GO:0000118  C:histone deacetylase complex  
GO:0033698  C:Rpd3L complex  
GO:0003712  F:transcription coregulator activity  
GO:0003714  F:transcription corepressor activity  
GO:0061188  P:negative regulation of rDNA heterochromatin formation  
GO:0061186  P:negative regulation of silent mating-type cassette heterochromatin formation  
GO:0016479  P:negative regulation of transcription by RNA polymerase I  
GO:2000219  P:positive regulation of invasive growth in response to glucose limitation  
GO:0061408  P:positive regulation of transcription from RNA polymerase II promoter in response to heat stress  
GO:0006355  P:regulation of DNA-templated transcription  
KEGG ago:AGOS_AER278W  -  
Pfam View protein in Pfam  
PF13867  SAP30_Sin3_bdg  
Amino Acid Sequences MPPKVYNSNSESESKTRGASAHHGGAVAPGGAANTRSNGKQRLTVAQQQYLKELVRTHIHNNHEENFPLLHPLDFEAYSDDFLRRYKDHYQIPLQDNLSLQGFLLGSELGSRTYSYRRNIPSQPDSRVTKKQLADEVRRHFTASMVKETECIPAFIYKVKNSKKKFRMEFRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.28
4 0.26
5 0.26
6 0.28
7 0.3
8 0.29
9 0.28
10 0.27
11 0.26
12 0.25
13 0.22
14 0.15
15 0.09
16 0.06
17 0.05
18 0.06
19 0.07
20 0.07
21 0.09
22 0.11
23 0.13
24 0.19
25 0.24
26 0.25
27 0.29
28 0.31
29 0.36
30 0.4
31 0.46
32 0.45
33 0.46
34 0.48
35 0.43
36 0.43
37 0.38
38 0.32
39 0.26
40 0.23
41 0.2
42 0.21
43 0.23
44 0.27
45 0.31
46 0.34
47 0.36
48 0.38
49 0.38
50 0.35
51 0.32
52 0.28
53 0.22
54 0.19
55 0.16
56 0.13
57 0.1
58 0.09
59 0.09
60 0.09
61 0.08
62 0.09
63 0.09
64 0.09
65 0.09
66 0.1
67 0.09
68 0.09
69 0.09
70 0.12
71 0.1
72 0.14
73 0.19
74 0.25
75 0.28
76 0.32
77 0.36
78 0.41
79 0.43
80 0.43
81 0.38
82 0.32
83 0.29
84 0.25
85 0.21
86 0.14
87 0.11
88 0.08
89 0.07
90 0.06
91 0.06
92 0.05
93 0.04
94 0.05
95 0.05
96 0.05
97 0.05
98 0.06
99 0.07
100 0.12
101 0.18
102 0.21
103 0.28
104 0.32
105 0.37
106 0.42
107 0.48
108 0.53
109 0.53
110 0.55
111 0.54
112 0.55
113 0.55
114 0.58
115 0.54
116 0.53
117 0.5
118 0.5
119 0.52
120 0.54
121 0.57
122 0.58
123 0.6
124 0.58
125 0.56
126 0.52
127 0.44
128 0.39
129 0.39
130 0.34
131 0.33
132 0.3
133 0.3
134 0.29
135 0.3
136 0.33
137 0.26
138 0.23
139 0.17
140 0.18
141 0.19
142 0.23
143 0.27
144 0.28
145 0.37
146 0.46
147 0.54
148 0.6
149 0.7
150 0.73
151 0.79
152 0.83