Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6EEK4

Protein Details
Accession A0A5N6EEK4    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
20-39AKRGKGKTATKQKQNSKSPVHydrophilic
NLS Segment(s)
PositionSequence
16-29KSEAAKRGKGKTAT
Subcellular Location(s) mito 8, plas 8, cyto 4, E.R. 3, nucl 1, pero 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR010580  ER_stress-assoc  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF06624  RAMP4  
Amino Acid Sequences MAQTPQQRKANEKYAKSEAAKRGKGKTATKQKQNSKSPVSTGWVVVLAFAVCGGLAFEALRIVPELWSAAVAMFNRKLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.63
3 0.6
4 0.6
5 0.58
6 0.59
7 0.61
8 0.58
9 0.57
10 0.57
11 0.61
12 0.59
13 0.6
14 0.62
15 0.65
16 0.7
17 0.74
18 0.76
19 0.79
20 0.8
21 0.77
22 0.71
23 0.64
24 0.57
25 0.49
26 0.43
27 0.34
28 0.26
29 0.2
30 0.14
31 0.12
32 0.1
33 0.09
34 0.05
35 0.04
36 0.04
37 0.03
38 0.02
39 0.02
40 0.03
41 0.02
42 0.03
43 0.03
44 0.03
45 0.04
46 0.04
47 0.04
48 0.05
49 0.06
50 0.06
51 0.06
52 0.07
53 0.07
54 0.07
55 0.07
56 0.06
57 0.09
58 0.1
59 0.14