Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6EVV4

Protein Details
Accession A0A5N6EVV4    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
33-65EDEQDQKPQRPKQQQARRRQQQQRKRQNDEYEDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12.333, cyto 7, cyto_pero 4.333
Family & Domain DBs
Amino Acid Sequences MATAEKKKEEQPAIQPDEYSDGDYDTDDYSLSEDEQDQKPQRPKQQQARRRQQQQRKRQNDEYEDESDYLSDEYDSDEYDDDDDAGQGNAMQPYKRGTQSLTQGTITNGAMTDAPGQGKNDEEQDGLKLKLELNLDIEVELKAHIHGDLTLSLLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.53
3 0.45
4 0.45
5 0.39
6 0.32
7 0.22
8 0.15
9 0.15
10 0.15
11 0.15
12 0.11
13 0.1
14 0.08
15 0.08
16 0.08
17 0.08
18 0.08
19 0.08
20 0.09
21 0.13
22 0.15
23 0.23
24 0.25
25 0.33
26 0.41
27 0.47
28 0.55
29 0.61
30 0.68
31 0.72
32 0.79
33 0.81
34 0.84
35 0.88
36 0.88
37 0.89
38 0.9
39 0.89
40 0.89
41 0.91
42 0.91
43 0.89
44 0.88
45 0.85
46 0.82
47 0.77
48 0.71
49 0.64
50 0.56
51 0.48
52 0.39
53 0.31
54 0.23
55 0.18
56 0.14
57 0.09
58 0.06
59 0.04
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.06
67 0.06
68 0.05
69 0.05
70 0.05
71 0.04
72 0.04
73 0.04
74 0.04
75 0.05
76 0.06
77 0.07
78 0.07
79 0.07
80 0.11
81 0.14
82 0.15
83 0.15
84 0.16
85 0.2
86 0.27
87 0.31
88 0.3
89 0.28
90 0.27
91 0.27
92 0.27
93 0.22
94 0.15
95 0.11
96 0.09
97 0.08
98 0.08
99 0.09
100 0.08
101 0.09
102 0.1
103 0.11
104 0.11
105 0.13
106 0.13
107 0.14
108 0.14
109 0.14
110 0.13
111 0.15
112 0.18
113 0.17
114 0.17
115 0.15
116 0.15
117 0.18
118 0.19
119 0.17
120 0.17
121 0.18
122 0.17
123 0.16
124 0.16
125 0.12
126 0.11
127 0.1
128 0.08
129 0.07
130 0.07
131 0.07
132 0.07
133 0.07
134 0.09
135 0.09