Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6ECR6

Protein Details
Accession A0A5N6ECR6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
16-36YPPSRPRFCRQPRSSSHKKLPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, cyto_mito 10, extr 6, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MHVFPLSLLIHHGQLYPPSRPRFCRQPRSSSHKKLPAASGADASRFYPLFYCCFPCDRGGRTGYLGVFVFIFIPSRIFSEPHLFFGTYILYKLVISLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.26
4 0.32
5 0.38
6 0.42
7 0.47
8 0.53
9 0.58
10 0.64
11 0.69
12 0.68
13 0.71
14 0.75
15 0.79
16 0.82
17 0.8
18 0.79
19 0.77
20 0.73
21 0.66
22 0.6
23 0.56
24 0.49
25 0.4
26 0.34
27 0.26
28 0.23
29 0.21
30 0.18
31 0.14
32 0.11
33 0.1
34 0.09
35 0.09
36 0.11
37 0.11
38 0.14
39 0.14
40 0.16
41 0.17
42 0.19
43 0.21
44 0.21
45 0.24
46 0.23
47 0.23
48 0.22
49 0.23
50 0.2
51 0.19
52 0.16
53 0.13
54 0.11
55 0.1
56 0.09
57 0.07
58 0.08
59 0.06
60 0.07
61 0.07
62 0.1
63 0.11
64 0.12
65 0.14
66 0.22
67 0.23
68 0.25
69 0.28
70 0.26
71 0.24
72 0.25
73 0.25
74 0.17
75 0.17
76 0.14
77 0.12
78 0.11