Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6E7V1

Protein Details
Accession A0A5N6E7V1   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
6-28ADSRKRRAARACLACRKRKTRCDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MSSAAADSRKRRAARACLACRKRKTRCDVARSGMPCNNCRLDGVECVVIKSRRGRYVARTKVHMMSRPLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.66
3 0.69
4 0.71
5 0.79
6 0.81
7 0.82
8 0.82
9 0.81
10 0.79
11 0.77
12 0.78
13 0.78
14 0.77
15 0.75
16 0.7
17 0.67
18 0.6
19 0.56
20 0.47
21 0.4
22 0.33
23 0.31
24 0.27
25 0.21
26 0.2
27 0.19
28 0.18
29 0.17
30 0.18
31 0.18
32 0.17
33 0.17
34 0.22
35 0.2
36 0.21
37 0.27
38 0.31
39 0.32
40 0.36
41 0.39
42 0.44
43 0.54
44 0.61
45 0.59
46 0.58
47 0.57
48 0.61
49 0.63
50 0.6