Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6EZ95

Protein Details
Accession A0A5N6EZ95    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
73-98DGKLHDAYKRCKRNKCRANQPYYPETHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 21, mito 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MVKIILSALAILAAIAPLTTAEKIKCNNATAYCGATLINRGGYLTEIREILKNHDEDPSGLLLQHGLFWCKEDGKLHDAYKRCKRNKCRANQPYYPETGDGCKGEWRGSILPDMNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.05
6 0.06
7 0.08
8 0.1
9 0.14
10 0.17
11 0.22
12 0.25
13 0.26
14 0.3
15 0.29
16 0.32
17 0.29
18 0.29
19 0.23
20 0.2
21 0.18
22 0.14
23 0.14
24 0.1
25 0.1
26 0.08
27 0.07
28 0.07
29 0.08
30 0.09
31 0.08
32 0.08
33 0.08
34 0.09
35 0.12
36 0.12
37 0.15
38 0.18
39 0.18
40 0.18
41 0.19
42 0.19
43 0.17
44 0.17
45 0.14
46 0.1
47 0.1
48 0.09
49 0.07
50 0.06
51 0.08
52 0.07
53 0.07
54 0.07
55 0.08
56 0.1
57 0.1
58 0.11
59 0.12
60 0.15
61 0.18
62 0.22
63 0.23
64 0.27
65 0.32
66 0.39
67 0.47
68 0.54
69 0.59
70 0.64
71 0.72
72 0.78
73 0.83
74 0.85
75 0.86
76 0.86
77 0.87
78 0.84
79 0.81
80 0.75
81 0.7
82 0.61
83 0.51
84 0.42
85 0.36
86 0.33
87 0.26
88 0.22
89 0.23
90 0.22
91 0.22
92 0.22
93 0.24
94 0.23
95 0.24
96 0.29