Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6EQ67

Protein Details
Accession A0A5N6EQ67    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
54-83RMWYPFPKTDKKEKGRKRLRRHVRVMICNMHydrophilic
NLS Segment(s)
PositionSequence
63-75DKKEKGRKRLRRH
Subcellular Location(s) mito 19, plas 4, vacu 2, nucl 1.5, cyto_nucl 1.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTRSYIILLPMTRKRADVSVLPLLNGAFGIFLFPHFHYRRRRVQGMFMNMMGGRMWYPFPKTDKKEKGRKRLRRHVRVMICNM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.32
4 0.28
5 0.29
6 0.32
7 0.31
8 0.3
9 0.28
10 0.26
11 0.22
12 0.18
13 0.12
14 0.04
15 0.03
16 0.04
17 0.03
18 0.04
19 0.07
20 0.08
21 0.16
22 0.17
23 0.24
24 0.32
25 0.39
26 0.47
27 0.52
28 0.57
29 0.5
30 0.57
31 0.58
32 0.55
33 0.5
34 0.41
35 0.35
36 0.29
37 0.28
38 0.2
39 0.13
40 0.07
41 0.06
42 0.07
43 0.08
44 0.1
45 0.15
46 0.2
47 0.29
48 0.35
49 0.45
50 0.55
51 0.63
52 0.72
53 0.77
54 0.83
55 0.85
56 0.9
57 0.9
58 0.91
59 0.93
60 0.92
61 0.92
62 0.91
63 0.9