Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6EWV2

Protein Details
Accession A0A5N6EWV2    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
107-132MHDAMGKKKKKTKPSIPQQHRSARSQHydrophilic
NLS Segment(s)
PositionSequence
112-128GKKKKKTKPSIPQQHRS
Subcellular Location(s) mito 19.5, mito_nucl 13, nucl 5.5
Family & Domain DBs
Amino Acid Sequences MRLSLGGKLDMRRRGCHHLTIMGKLTIIMDSYGASTKSPGGPAHTIPICMAHKKLSFYFLFFYCYFVFLSKHSNQQYVMVLLCHFSLTVTRSLSSVDRPGYFTTGMMHDAMGKKKKKTKPSIPQQHRSARSQTKLRKALGCHPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.55
3 0.55
4 0.51
5 0.51
6 0.51
7 0.49
8 0.47
9 0.38
10 0.34
11 0.28
12 0.25
13 0.17
14 0.15
15 0.1
16 0.06
17 0.06
18 0.07
19 0.09
20 0.09
21 0.08
22 0.09
23 0.1
24 0.11
25 0.14
26 0.13
27 0.16
28 0.18
29 0.19
30 0.24
31 0.23
32 0.22
33 0.19
34 0.24
35 0.22
36 0.21
37 0.21
38 0.2
39 0.21
40 0.23
41 0.24
42 0.23
43 0.22
44 0.22
45 0.23
46 0.19
47 0.21
48 0.19
49 0.21
50 0.16
51 0.17
52 0.16
53 0.14
54 0.14
55 0.11
56 0.17
57 0.15
58 0.22
59 0.22
60 0.23
61 0.22
62 0.24
63 0.24
64 0.19
65 0.17
66 0.11
67 0.1
68 0.09
69 0.08
70 0.06
71 0.05
72 0.04
73 0.06
74 0.07
75 0.1
76 0.1
77 0.11
78 0.11
79 0.12
80 0.14
81 0.14
82 0.16
83 0.16
84 0.16
85 0.18
86 0.19
87 0.2
88 0.19
89 0.17
90 0.15
91 0.14
92 0.14
93 0.12
94 0.11
95 0.12
96 0.16
97 0.23
98 0.29
99 0.33
100 0.39
101 0.48
102 0.56
103 0.63
104 0.7
105 0.75
106 0.77
107 0.84
108 0.89
109 0.89
110 0.91
111 0.9
112 0.89
113 0.83
114 0.78
115 0.76
116 0.74
117 0.72
118 0.72
119 0.73
120 0.73
121 0.75
122 0.75
123 0.72
124 0.68