Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179UNR2

Protein Details
Accession A0A179UNR2    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MKRERKKKSVAKLTEKKRIEBasic
NLS Segment(s)
PositionSequence
3-17RERKKKSVAKLTEKK
Subcellular Location(s) mito_nucl 12.833, nucl 12.5, mito 12, cyto_mito 7.333
Family & Domain DBs
Amino Acid Sequences MKRERKKKSVAKLTEKKRIEALFRSQMCFMIQDIKEAALLSEHVNLLAAEVKPETADQKMRDFEMQIDLTEKKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.8
3 0.7
4 0.66
5 0.59
6 0.53
7 0.48
8 0.47
9 0.46
10 0.45
11 0.45
12 0.39
13 0.37
14 0.32
15 0.27
16 0.2
17 0.19
18 0.17
19 0.16
20 0.16
21 0.15
22 0.15
23 0.14
24 0.13
25 0.05
26 0.06
27 0.06
28 0.07
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.09
35 0.08
36 0.08
37 0.08
38 0.08
39 0.08
40 0.09
41 0.1
42 0.11
43 0.16
44 0.18
45 0.24
46 0.26
47 0.28
48 0.29
49 0.28
50 0.26
51 0.28
52 0.27
53 0.22
54 0.24