Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179ULT7

Protein Details
Accession A0A179ULT7    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
199-224RALDSKPSPPSKKKNNNNSNNNNNDNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038906  TTC36  
KEGG bgh:BDBG_03442  -  
Amino Acid Sequences MATATTAVTASAPHLSANDSAVLQALFDAESSLSNASTGIHLDSSLPQQLPGISPAELSKLQALERAAILPLQAETTGRDTIRDANKIRAAVAKLTAIIEENKGYASAYVNRAQAARMLVESGMDGNEKDEEEQRELANMIFADLSTVISLLSPSPSSSSYSPSLSSASQHPSPLSPLHARILANAHTHRAYIVYRAARALDSKPSPPSKKKNNNNSNNNNNDNTTPGTATLTTLPVHLRDKSAQHLEEMASMDFQLGGRYGNEIARQMAVKTNPYAKMCGAIVKEAMRKEMMVHRGEGEGEGEGEGFVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.13
4 0.14
5 0.14
6 0.12
7 0.11
8 0.12
9 0.11
10 0.09
11 0.08
12 0.07
13 0.06
14 0.06
15 0.06
16 0.05
17 0.06
18 0.08
19 0.08
20 0.08
21 0.08
22 0.08
23 0.08
24 0.08
25 0.09
26 0.08
27 0.08
28 0.08
29 0.09
30 0.11
31 0.14
32 0.18
33 0.17
34 0.16
35 0.16
36 0.17
37 0.17
38 0.17
39 0.16
40 0.12
41 0.12
42 0.13
43 0.16
44 0.15
45 0.15
46 0.15
47 0.14
48 0.14
49 0.17
50 0.17
51 0.15
52 0.15
53 0.15
54 0.12
55 0.11
56 0.11
57 0.08
58 0.08
59 0.07
60 0.07
61 0.06
62 0.08
63 0.11
64 0.14
65 0.13
66 0.14
67 0.14
68 0.22
69 0.27
70 0.32
71 0.3
72 0.34
73 0.37
74 0.37
75 0.37
76 0.34
77 0.3
78 0.25
79 0.24
80 0.18
81 0.16
82 0.16
83 0.15
84 0.12
85 0.11
86 0.1
87 0.09
88 0.09
89 0.08
90 0.08
91 0.08
92 0.07
93 0.09
94 0.11
95 0.14
96 0.18
97 0.19
98 0.19
99 0.2
100 0.19
101 0.19
102 0.16
103 0.13
104 0.09
105 0.09
106 0.08
107 0.08
108 0.08
109 0.06
110 0.05
111 0.05
112 0.05
113 0.05
114 0.06
115 0.06
116 0.07
117 0.1
118 0.12
119 0.14
120 0.15
121 0.14
122 0.14
123 0.15
124 0.13
125 0.11
126 0.08
127 0.07
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.04
134 0.04
135 0.03
136 0.03
137 0.04
138 0.03
139 0.04
140 0.04
141 0.04
142 0.06
143 0.06
144 0.09
145 0.1
146 0.13
147 0.14
148 0.15
149 0.16
150 0.15
151 0.16
152 0.14
153 0.15
154 0.14
155 0.16
156 0.16
157 0.16
158 0.16
159 0.15
160 0.17
161 0.16
162 0.17
163 0.15
164 0.16
165 0.16
166 0.19
167 0.18
168 0.17
169 0.19
170 0.18
171 0.2
172 0.19
173 0.2
174 0.17
175 0.18
176 0.16
177 0.15
178 0.13
179 0.12
180 0.17
181 0.16
182 0.16
183 0.17
184 0.17
185 0.16
186 0.18
187 0.17
188 0.18
189 0.19
190 0.21
191 0.26
192 0.33
193 0.4
194 0.46
195 0.54
196 0.59
197 0.67
198 0.75
199 0.81
200 0.84
201 0.88
202 0.9
203 0.9
204 0.88
205 0.85
206 0.79
207 0.69
208 0.6
209 0.5
210 0.42
211 0.35
212 0.26
213 0.19
214 0.16
215 0.15
216 0.14
217 0.14
218 0.13
219 0.12
220 0.11
221 0.12
222 0.12
223 0.14
224 0.17
225 0.17
226 0.19
227 0.21
228 0.23
229 0.29
230 0.35
231 0.32
232 0.3
233 0.31
234 0.28
235 0.27
236 0.26
237 0.2
238 0.13
239 0.13
240 0.12
241 0.1
242 0.09
243 0.08
244 0.06
245 0.07
246 0.07
247 0.09
248 0.1
249 0.12
250 0.14
251 0.14
252 0.15
253 0.16
254 0.17
255 0.16
256 0.21
257 0.21
258 0.23
259 0.26
260 0.31
261 0.34
262 0.36
263 0.37
264 0.32
265 0.33
266 0.3
267 0.32
268 0.27
269 0.23
270 0.24
271 0.27
272 0.31
273 0.29
274 0.31
275 0.26
276 0.25
277 0.27
278 0.32
279 0.33
280 0.31
281 0.32
282 0.31
283 0.31
284 0.31
285 0.28
286 0.21
287 0.15
288 0.13
289 0.11
290 0.1