Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UKJ6

Protein Details
Accession A0A179UKJ6    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
58-77FEMIIISNKKEKKKKKKNEKBasic
NLS Segment(s)
PositionSequence
66-77KKEKKKKKKNEK
Subcellular Location(s) nucl 15, cyto 8, mito 3
Family & Domain DBs
Amino Acid Sequences MIQNIEKAALLSEHVNLLITEVEPEAANQEMWDFETQVDLTKREQQKPFSEKAAERDFEMIIISNKKEKKKKKKNEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.09
5 0.08
6 0.07
7 0.07
8 0.06
9 0.07
10 0.06
11 0.06
12 0.07
13 0.07
14 0.06
15 0.06
16 0.06
17 0.05
18 0.07
19 0.07
20 0.06
21 0.06
22 0.07
23 0.07
24 0.1
25 0.11
26 0.11
27 0.12
28 0.19
29 0.24
30 0.3
31 0.34
32 0.36
33 0.44
34 0.48
35 0.5
36 0.46
37 0.46
38 0.41
39 0.44
40 0.46
41 0.38
42 0.33
43 0.32
44 0.28
45 0.23
46 0.22
47 0.16
48 0.13
49 0.16
50 0.17
51 0.22
52 0.28
53 0.37
54 0.47
55 0.56
56 0.65
57 0.73