Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179UJW1

Protein Details
Accession A0A179UJW1    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
223-265YMTPRKLEWKGNPNPKPKEVKPKESKPKEPKVKNEAKKPQDDNHydrophilic
NLS Segment(s)
PositionSequence
230-260EWKGNPNPKPKEVKPKESKPKEPKVKNEAKK
Subcellular Location(s) nucl 13, cyto 10, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002305  aa-tRNA-synth_Ic  
IPR014729  Rossmann-like_a/b/a_fold  
IPR002306  Trp-tRNA-ligase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004830  F:tryptophan-tRNA ligase activity  
GO:0006436  P:tryptophanyl-tRNA aminoacylation  
Pfam View protein in Pfam  
PF00579  tRNA-synt_1b  
Amino Acid Sequences MNVWEFSKLVTFNQVRGAFGFNESTNIGRIMFPAVQCAAAFATSYPEIWSDNPSAVRTKDIGKIPCLIPMAIDQDPYFRLVRDNASRMRFPGPKPALIHSKFLTALQGIGGKMSASDPNSAIFMTDTPNQIKKKITRHAFSGGRDNIEEHRRLGGNPDVDVSFQYLSYFEEDDEKLKKIEEGYRKGEILTGELKMMAITLLQEYVAEFQERRKLVTDELLKQYMTPRKLEWKGNPNPKPKEVKPKESKPKEPKVKNEAKKPQDDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.31
4 0.33
5 0.24
6 0.25
7 0.26
8 0.17
9 0.19
10 0.19
11 0.18
12 0.16
13 0.16
14 0.15
15 0.12
16 0.13
17 0.14
18 0.16
19 0.15
20 0.17
21 0.17
22 0.17
23 0.16
24 0.16
25 0.13
26 0.1
27 0.11
28 0.07
29 0.11
30 0.11
31 0.11
32 0.11
33 0.11
34 0.12
35 0.13
36 0.17
37 0.14
38 0.17
39 0.18
40 0.19
41 0.22
42 0.21
43 0.23
44 0.21
45 0.23
46 0.26
47 0.31
48 0.32
49 0.31
50 0.34
51 0.32
52 0.34
53 0.32
54 0.25
55 0.19
56 0.19
57 0.22
58 0.17
59 0.18
60 0.14
61 0.14
62 0.15
63 0.17
64 0.15
65 0.11
66 0.12
67 0.13
68 0.19
69 0.23
70 0.27
71 0.31
72 0.34
73 0.35
74 0.35
75 0.39
76 0.38
77 0.34
78 0.4
79 0.37
80 0.37
81 0.38
82 0.41
83 0.44
84 0.41
85 0.44
86 0.34
87 0.33
88 0.29
89 0.27
90 0.24
91 0.14
92 0.12
93 0.09
94 0.1
95 0.08
96 0.08
97 0.07
98 0.06
99 0.06
100 0.07
101 0.08
102 0.07
103 0.08
104 0.09
105 0.09
106 0.1
107 0.09
108 0.09
109 0.07
110 0.06
111 0.08
112 0.1
113 0.11
114 0.13
115 0.19
116 0.19
117 0.21
118 0.25
119 0.28
120 0.34
121 0.4
122 0.45
123 0.42
124 0.45
125 0.5
126 0.5
127 0.46
128 0.47
129 0.4
130 0.34
131 0.32
132 0.3
133 0.26
134 0.26
135 0.25
136 0.17
137 0.19
138 0.18
139 0.18
140 0.2
141 0.2
142 0.17
143 0.17
144 0.17
145 0.15
146 0.14
147 0.15
148 0.13
149 0.09
150 0.07
151 0.07
152 0.07
153 0.07
154 0.09
155 0.09
156 0.07
157 0.1
158 0.11
159 0.13
160 0.15
161 0.15
162 0.14
163 0.14
164 0.15
165 0.15
166 0.22
167 0.28
168 0.32
169 0.36
170 0.39
171 0.39
172 0.38
173 0.37
174 0.29
175 0.23
176 0.19
177 0.15
178 0.12
179 0.12
180 0.12
181 0.09
182 0.09
183 0.06
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.05
191 0.07
192 0.08
193 0.09
194 0.09
195 0.12
196 0.19
197 0.2
198 0.21
199 0.23
200 0.24
201 0.25
202 0.33
203 0.37
204 0.36
205 0.41
206 0.41
207 0.37
208 0.36
209 0.42
210 0.41
211 0.37
212 0.33
213 0.31
214 0.39
215 0.46
216 0.53
217 0.55
218 0.58
219 0.66
220 0.74
221 0.79
222 0.79
223 0.8
224 0.8
225 0.8
226 0.77
227 0.79
228 0.77
229 0.79
230 0.8
231 0.84
232 0.87
233 0.88
234 0.91
235 0.9
236 0.92
237 0.92
238 0.91
239 0.9
240 0.89
241 0.9
242 0.89
243 0.89
244 0.89
245 0.87