Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UEV4

Protein Details
Accession A0A179UEV4    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
143-169GSIAEDKLKDKKKKKKHDGHHHHGSSHBasic
NLS Segment(s)
PositionSequence
150-160LKDKKKKKKHD
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008816  Gly_zipper_2TM_dom  
Gene Ontology GO:0019867  C:outer membrane  
KEGG bgh:BDBG_02525  -  
Pfam View protein in Pfam  
PF05433  Rick_17kDa_Anti  
Amino Acid Sequences MSGPYDNQNPNYYGQGGYPPQQGYGQPQTDPYNQGQYPPQQGYGQPAYGQQPPQQQYGGGDQQAYYGQQQQPYDPNQQAYQQQPQYDQQGVQQQQHQQDGAPGGAQQGERGIGGALTGGLAGGFMGHKANHGILGTIGGAIIGSIAEDKLKDKKKKKKHDGHHHHGSSHHGGSGYGGSQFGGGGSSSNFLGSAAGSLFGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.25
4 0.27
5 0.3
6 0.27
7 0.27
8 0.28
9 0.28
10 0.29
11 0.34
12 0.33
13 0.28
14 0.32
15 0.35
16 0.36
17 0.39
18 0.34
19 0.34
20 0.32
21 0.34
22 0.35
23 0.35
24 0.38
25 0.36
26 0.36
27 0.29
28 0.3
29 0.34
30 0.33
31 0.28
32 0.22
33 0.23
34 0.24
35 0.26
36 0.27
37 0.25
38 0.3
39 0.32
40 0.33
41 0.31
42 0.28
43 0.27
44 0.3
45 0.29
46 0.21
47 0.19
48 0.17
49 0.17
50 0.18
51 0.16
52 0.11
53 0.15
54 0.16
55 0.19
56 0.19
57 0.2
58 0.24
59 0.28
60 0.32
61 0.27
62 0.28
63 0.25
64 0.28
65 0.3
66 0.29
67 0.33
68 0.29
69 0.29
70 0.29
71 0.3
72 0.31
73 0.28
74 0.24
75 0.2
76 0.25
77 0.26
78 0.25
79 0.27
80 0.28
81 0.29
82 0.3
83 0.27
84 0.19
85 0.19
86 0.17
87 0.14
88 0.1
89 0.07
90 0.06
91 0.08
92 0.07
93 0.06
94 0.05
95 0.06
96 0.05
97 0.06
98 0.05
99 0.03
100 0.03
101 0.03
102 0.03
103 0.02
104 0.02
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.02
112 0.04
113 0.04
114 0.04
115 0.06
116 0.06
117 0.07
118 0.07
119 0.07
120 0.06
121 0.07
122 0.06
123 0.05
124 0.05
125 0.04
126 0.03
127 0.03
128 0.03
129 0.02
130 0.02
131 0.02
132 0.03
133 0.03
134 0.04
135 0.06
136 0.15
137 0.25
138 0.34
139 0.44
140 0.55
141 0.66
142 0.77
143 0.86
144 0.88
145 0.9
146 0.92
147 0.94
148 0.93
149 0.93
150 0.85
151 0.75
152 0.67
153 0.62
154 0.56
155 0.45
156 0.37
157 0.26
158 0.23
159 0.22
160 0.22
161 0.16
162 0.11
163 0.1
164 0.09
165 0.08
166 0.08
167 0.07
168 0.06
169 0.05
170 0.06
171 0.06
172 0.08
173 0.08
174 0.08
175 0.08
176 0.07
177 0.08
178 0.07
179 0.07
180 0.06
181 0.08