Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6F2I8

Protein Details
Accession A0A5N6F2I8    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
127-147SENPGNRRTRRDTPNSDCRDCHydrophilic
NLS Segment(s)
PositionSequence
115-121RKRRRRG
Subcellular Location(s) nucl 17, plas 4, golg 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGKGPQLSKWLQRPETDYERWLRKQDEHFKPGDRPLYGPDMEGTNDVDEIGANKDGDKSLSNSHKAPTAYGHFTGQQSMPTLSSTSLLPRLNNYAVIGSLLVSIVLTFAILKAFRKRRRRGGVILVSENPGNRRTRRDTPNSDCRDCLFND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.59
3 0.53
4 0.5
5 0.48
6 0.53
7 0.53
8 0.54
9 0.5
10 0.49
11 0.57
12 0.63
13 0.64
14 0.61
15 0.61
16 0.6
17 0.6
18 0.59
19 0.55
20 0.45
21 0.37
22 0.35
23 0.37
24 0.33
25 0.29
26 0.23
27 0.19
28 0.18
29 0.18
30 0.15
31 0.1
32 0.1
33 0.09
34 0.08
35 0.06
36 0.07
37 0.07
38 0.08
39 0.07
40 0.08
41 0.08
42 0.09
43 0.1
44 0.1
45 0.1
46 0.16
47 0.21
48 0.23
49 0.24
50 0.24
51 0.27
52 0.26
53 0.25
54 0.21
55 0.2
56 0.2
57 0.2
58 0.21
59 0.18
60 0.18
61 0.19
62 0.16
63 0.13
64 0.11
65 0.11
66 0.1
67 0.09
68 0.09
69 0.08
70 0.09
71 0.08
72 0.08
73 0.13
74 0.13
75 0.13
76 0.14
77 0.17
78 0.17
79 0.17
80 0.16
81 0.12
82 0.11
83 0.11
84 0.09
85 0.06
86 0.05
87 0.05
88 0.04
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.02
95 0.03
96 0.05
97 0.05
98 0.08
99 0.18
100 0.28
101 0.37
102 0.48
103 0.56
104 0.65
105 0.75
106 0.79
107 0.77
108 0.78
109 0.78
110 0.74
111 0.7
112 0.6
113 0.52
114 0.46
115 0.41
116 0.32
117 0.28
118 0.28
119 0.27
120 0.33
121 0.4
122 0.49
123 0.57
124 0.65
125 0.7
126 0.74
127 0.81
128 0.82
129 0.77
130 0.69
131 0.62