Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UBJ6

Protein Details
Accession A0A179UBJ6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
156-179WAGVRWWKSGKGRRREEKESESEMHydrophilic
NLS Segment(s)
PositionSequence
168-168R
Subcellular Location(s) plas 19, mito 4, E.R. 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG bgh:BDBG_01189  -  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MTIKALILDGVRKRYSVGSTVGTVVGCSLRFLQFVFAIAVIGLYAQDLVKQRKDGGGYDPKWTYATSLGTISSLSAAVYFTIPLVMPAFSLLPTVNLPTLVYDSILSILWLTLFGIFGKLYITRDAPEGHVDTIRMKHAVWVDLANLALWTATAAWAGVRWWKSGKGRRREEKESESEMGEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.28
4 0.27
5 0.24
6 0.24
7 0.26
8 0.25
9 0.21
10 0.18
11 0.15
12 0.13
13 0.1
14 0.1
15 0.11
16 0.11
17 0.11
18 0.12
19 0.14
20 0.12
21 0.14
22 0.13
23 0.11
24 0.1
25 0.09
26 0.08
27 0.06
28 0.05
29 0.04
30 0.03
31 0.03
32 0.03
33 0.06
34 0.11
35 0.15
36 0.18
37 0.19
38 0.2
39 0.23
40 0.25
41 0.23
42 0.26
43 0.32
44 0.31
45 0.35
46 0.34
47 0.32
48 0.32
49 0.3
50 0.24
51 0.16
52 0.16
53 0.13
54 0.13
55 0.12
56 0.11
57 0.11
58 0.1
59 0.07
60 0.06
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.05
72 0.04
73 0.04
74 0.05
75 0.05
76 0.04
77 0.05
78 0.05
79 0.05
80 0.05
81 0.06
82 0.06
83 0.06
84 0.06
85 0.05
86 0.07
87 0.06
88 0.06
89 0.05
90 0.05
91 0.06
92 0.06
93 0.06
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.03
100 0.04
101 0.04
102 0.04
103 0.04
104 0.05
105 0.06
106 0.06
107 0.08
108 0.09
109 0.1
110 0.1
111 0.12
112 0.13
113 0.13
114 0.15
115 0.16
116 0.15
117 0.15
118 0.15
119 0.16
120 0.17
121 0.17
122 0.15
123 0.13
124 0.16
125 0.18
126 0.18
127 0.17
128 0.16
129 0.15
130 0.15
131 0.15
132 0.11
133 0.09
134 0.07
135 0.06
136 0.05
137 0.05
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.05
144 0.06
145 0.12
146 0.13
147 0.15
148 0.18
149 0.25
150 0.34
151 0.44
152 0.53
153 0.57
154 0.67
155 0.75
156 0.82
157 0.84
158 0.83
159 0.82
160 0.8
161 0.76
162 0.68