Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UWQ7

Protein Details
Accession A0A179UWQ7    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGKRKKSSRKPAAPRKKEPLPTTFBasic
NLS Segment(s)
PositionSequence
3-18KRKKSSRKPAAPRKKE
Subcellular Location(s) mito 14, cyto 8.5, cyto_nucl 6.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRKPAAPRKKEPLPTTFSCLFCNHENCVIVKLDKKLGLGNLSCKICGQRFQTGINYLSAAVDVYSDWVDACDAVAKDAAAGNAVETTARGANEGSSGPVRREAEREELDQSEVGLDDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.9
3 0.88
4 0.86
5 0.8
6 0.76
7 0.72
8 0.65
9 0.63
10 0.59
11 0.51
12 0.45
13 0.41
14 0.38
15 0.36
16 0.35
17 0.31
18 0.29
19 0.29
20 0.27
21 0.27
22 0.25
23 0.21
24 0.22
25 0.22
26 0.21
27 0.21
28 0.21
29 0.2
30 0.2
31 0.22
32 0.2
33 0.21
34 0.24
35 0.23
36 0.22
37 0.21
38 0.22
39 0.19
40 0.23
41 0.23
42 0.23
43 0.25
44 0.26
45 0.29
46 0.29
47 0.28
48 0.23
49 0.2
50 0.14
51 0.12
52 0.1
53 0.08
54 0.05
55 0.04
56 0.03
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.06
66 0.06
67 0.07
68 0.07
69 0.07
70 0.07
71 0.08
72 0.08
73 0.06
74 0.06
75 0.05
76 0.05
77 0.05
78 0.05
79 0.04
80 0.06
81 0.07
82 0.07
83 0.08
84 0.08
85 0.08
86 0.1
87 0.1
88 0.11
89 0.13
90 0.15
91 0.15
92 0.22
93 0.24
94 0.24
95 0.28
96 0.29
97 0.34
98 0.36
99 0.37
100 0.35
101 0.34
102 0.34
103 0.3
104 0.26
105 0.19