Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6EX23

Protein Details
Accession A0A5N6EX23    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
187-209SITTPYFRRRRPRSEKDGASKDAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 13, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR001544  Aminotrans_IV  
IPR036038  Aminotransferase-like  
IPR043132  BCAT-like_C  
IPR043131  BCAT-like_N  
Gene Ontology GO:0008483  F:transaminase activity  
Pfam View protein in Pfam  
PF01063  Aminotran_4  
Amino Acid Sequences MASTPSTASSDSFEIISSLRYDPSIPHAIGERTAEPHLLATPYYLLPYHRDRLLNAAICFNWTKAIEFLQQDLGQFTQILDTFIPDKSESWRLRIVIDSSGACKVEANPTASMNPLNLLYPSQEMSQPNTWRVYVDSEPTTPSDFTMHKTTARGDYTAARHRSGILSPQEQAEVLVVNPKGEVMEGSITTPYFRRRRPRSEKDGASKDAGPEWVTPPLLSGGNAGTTRRYALTEGFCTEEVITVADLVDGEECWLSNGVRGFIPGRIVLMDPKGPERVPPPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.14
4 0.13
5 0.12
6 0.12
7 0.13
8 0.13
9 0.14
10 0.2
11 0.25
12 0.22
13 0.22
14 0.26
15 0.26
16 0.27
17 0.29
18 0.24
19 0.21
20 0.22
21 0.22
22 0.18
23 0.18
24 0.17
25 0.15
26 0.13
27 0.11
28 0.12
29 0.12
30 0.13
31 0.12
32 0.12
33 0.16
34 0.22
35 0.25
36 0.27
37 0.28
38 0.28
39 0.33
40 0.39
41 0.4
42 0.35
43 0.34
44 0.29
45 0.3
46 0.3
47 0.24
48 0.21
49 0.16
50 0.16
51 0.14
52 0.17
53 0.2
54 0.2
55 0.21
56 0.22
57 0.22
58 0.21
59 0.21
60 0.18
61 0.14
62 0.13
63 0.11
64 0.09
65 0.09
66 0.09
67 0.08
68 0.09
69 0.1
70 0.1
71 0.12
72 0.1
73 0.11
74 0.14
75 0.23
76 0.23
77 0.25
78 0.28
79 0.27
80 0.28
81 0.29
82 0.27
83 0.2
84 0.2
85 0.17
86 0.15
87 0.16
88 0.16
89 0.13
90 0.12
91 0.11
92 0.15
93 0.17
94 0.18
95 0.18
96 0.18
97 0.19
98 0.19
99 0.18
100 0.13
101 0.1
102 0.08
103 0.08
104 0.07
105 0.07
106 0.07
107 0.08
108 0.09
109 0.09
110 0.11
111 0.12
112 0.16
113 0.21
114 0.22
115 0.23
116 0.23
117 0.23
118 0.2
119 0.2
120 0.2
121 0.15
122 0.17
123 0.16
124 0.16
125 0.16
126 0.17
127 0.17
128 0.13
129 0.12
130 0.12
131 0.11
132 0.13
133 0.16
134 0.16
135 0.16
136 0.17
137 0.18
138 0.2
139 0.21
140 0.18
141 0.16
142 0.19
143 0.23
144 0.3
145 0.3
146 0.26
147 0.25
148 0.26
149 0.26
150 0.22
151 0.24
152 0.2
153 0.2
154 0.2
155 0.2
156 0.2
157 0.18
158 0.17
159 0.11
160 0.07
161 0.05
162 0.09
163 0.09
164 0.09
165 0.08
166 0.08
167 0.08
168 0.08
169 0.08
170 0.05
171 0.06
172 0.06
173 0.07
174 0.08
175 0.08
176 0.09
177 0.11
178 0.18
179 0.23
180 0.29
181 0.39
182 0.47
183 0.58
184 0.68
185 0.76
186 0.78
187 0.82
188 0.84
189 0.83
190 0.81
191 0.73
192 0.66
193 0.57
194 0.48
195 0.4
196 0.33
197 0.24
198 0.19
199 0.18
200 0.18
201 0.17
202 0.16
203 0.15
204 0.15
205 0.14
206 0.13
207 0.12
208 0.09
209 0.12
210 0.13
211 0.13
212 0.12
213 0.12
214 0.14
215 0.14
216 0.14
217 0.13
218 0.17
219 0.21
220 0.23
221 0.24
222 0.25
223 0.24
224 0.24
225 0.22
226 0.19
227 0.14
228 0.12
229 0.11
230 0.08
231 0.08
232 0.07
233 0.06
234 0.06
235 0.06
236 0.05
237 0.06
238 0.06
239 0.06
240 0.07
241 0.08
242 0.08
243 0.11
244 0.13
245 0.14
246 0.14
247 0.16
248 0.16
249 0.17
250 0.19
251 0.16
252 0.15
253 0.15
254 0.16
255 0.17
256 0.19
257 0.21
258 0.21
259 0.24
260 0.27
261 0.26
262 0.29