Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6E508

Protein Details
Accession A0A5N6E508    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-38MSKNVKKSSWIKKRYSESSRAKSQQRQRRKSSLFKKAAHydrophilic
NLS Segment(s)
PositionSequence
12-30KKRYSESSRAKSQQRQRRK
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MSKNVKKSSWIKKRYSESSRAKSQQRQRRKSSLFKKAAEFSLECESDVVVAIRIRKTGGVVKDTPELGIFLSPSNSSDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.77
4 0.76
5 0.75
6 0.78
7 0.75
8 0.74
9 0.73
10 0.76
11 0.76
12 0.77
13 0.78
14 0.76
15 0.8
16 0.79
17 0.8
18 0.8
19 0.81
20 0.77
21 0.71
22 0.67
23 0.59
24 0.54
25 0.46
26 0.36
27 0.28
28 0.25
29 0.23
30 0.18
31 0.16
32 0.14
33 0.11
34 0.12
35 0.09
36 0.06
37 0.07
38 0.09
39 0.1
40 0.1
41 0.11
42 0.11
43 0.13
44 0.17
45 0.2
46 0.23
47 0.24
48 0.26
49 0.29
50 0.29
51 0.27
52 0.22
53 0.19
54 0.14
55 0.14
56 0.11
57 0.09
58 0.11
59 0.11