Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6ES25

Protein Details
Accession A0A5N6ES25    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
107-133EESVKPKPSVKARKPRPHRKSVQLLGNHydrophilic
NLS Segment(s)
PositionSequence
111-126KPKPSVKARKPRPHRK
Subcellular Location(s) nucl 22, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MAWFPADANWNDLYLPLGTEEELKDLETILRDIPQPLDQDHFVSSSSQSSAPTVDGTTPDPHSLIAPPSNHSTGLDNQPMMSFDSPVFSNTYQPQGTPVPPTEQPLEESVKPKPSVKARKPRPHRKSVQLLGNSTTPLRCGWKDCEYNGTFGRKAELMRHIDVLHVSPHSYDCPVRGCRKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.09
4 0.09
5 0.09
6 0.11
7 0.11
8 0.11
9 0.12
10 0.12
11 0.11
12 0.1
13 0.11
14 0.11
15 0.11
16 0.1
17 0.12
18 0.12
19 0.13
20 0.15
21 0.17
22 0.17
23 0.18
24 0.2
25 0.19
26 0.2
27 0.2
28 0.18
29 0.15
30 0.15
31 0.14
32 0.12
33 0.13
34 0.12
35 0.12
36 0.12
37 0.12
38 0.11
39 0.11
40 0.1
41 0.09
42 0.1
43 0.12
44 0.14
45 0.14
46 0.14
47 0.14
48 0.13
49 0.13
50 0.13
51 0.13
52 0.14
53 0.14
54 0.16
55 0.19
56 0.19
57 0.19
58 0.18
59 0.19
60 0.18
61 0.22
62 0.22
63 0.18
64 0.17
65 0.17
66 0.17
67 0.17
68 0.13
69 0.09
70 0.07
71 0.09
72 0.09
73 0.09
74 0.11
75 0.09
76 0.11
77 0.12
78 0.16
79 0.14
80 0.14
81 0.16
82 0.16
83 0.17
84 0.16
85 0.16
86 0.16
87 0.17
88 0.19
89 0.18
90 0.17
91 0.17
92 0.18
93 0.2
94 0.19
95 0.21
96 0.2
97 0.24
98 0.25
99 0.26
100 0.29
101 0.35
102 0.44
103 0.51
104 0.6
105 0.66
106 0.75
107 0.84
108 0.9
109 0.89
110 0.88
111 0.86
112 0.85
113 0.84
114 0.81
115 0.78
116 0.72
117 0.65
118 0.57
119 0.51
120 0.42
121 0.33
122 0.26
123 0.18
124 0.15
125 0.17
126 0.16
127 0.19
128 0.24
129 0.32
130 0.36
131 0.36
132 0.44
133 0.4
134 0.43
135 0.43
136 0.42
137 0.35
138 0.31
139 0.33
140 0.26
141 0.26
142 0.27
143 0.31
144 0.31
145 0.32
146 0.34
147 0.31
148 0.31
149 0.3
150 0.27
151 0.21
152 0.17
153 0.15
154 0.14
155 0.16
156 0.16
157 0.19
158 0.18
159 0.19
160 0.25
161 0.32