Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6E6X1

Protein Details
Accession A0A5N6E6X1   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
78-99SWSSRSRSRSRGSRRCRDRSYSHydrophilic
NLS Segment(s)
PositionSequence
54-92YRSRSRSRSASRSRMLSRSRSRSRSWSSRSRSRSRGSRR
Subcellular Location(s) nucl 20.5, cyto_nucl 12, cyto 2.5, mito 2
Family & Domain DBs
Amino Acid Sequences MSATARGRSPNRSPLDPGPEQASTPMRRTMSPRSESRPGSERCPSSDNVRRNGYRSRSRSRSASRSRMLSRSRSRSRSWSSRSRSRSRGSRRCRDRSYSEAPSPSDSLPRSSKVCVIAHCCPICALYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.59
3 0.53
4 0.49
5 0.44
6 0.39
7 0.35
8 0.33
9 0.33
10 0.28
11 0.29
12 0.32
13 0.29
14 0.3
15 0.35
16 0.41
17 0.43
18 0.46
19 0.49
20 0.5
21 0.56
22 0.55
23 0.55
24 0.53
25 0.47
26 0.47
27 0.48
28 0.43
29 0.39
30 0.41
31 0.38
32 0.37
33 0.43
34 0.43
35 0.42
36 0.46
37 0.44
38 0.44
39 0.5
40 0.49
41 0.5
42 0.52
43 0.55
44 0.55
45 0.57
46 0.61
47 0.6
48 0.63
49 0.61
50 0.62
51 0.57
52 0.57
53 0.56
54 0.56
55 0.53
56 0.52
57 0.52
58 0.53
59 0.58
60 0.57
61 0.57
62 0.58
63 0.62
64 0.63
65 0.61
66 0.61
67 0.61
68 0.66
69 0.72
70 0.71
71 0.7
72 0.68
73 0.72
74 0.73
75 0.76
76 0.76
77 0.79
78 0.81
79 0.84
80 0.83
81 0.8
82 0.76
83 0.73
84 0.72
85 0.69
86 0.64
87 0.59
88 0.54
89 0.5
90 0.46
91 0.39
92 0.36
93 0.29
94 0.3
95 0.29
96 0.32
97 0.31
98 0.31
99 0.34
100 0.33
101 0.36
102 0.36
103 0.39
104 0.41
105 0.47
106 0.45
107 0.42
108 0.37