Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6E5S9

Protein Details
Accession A0A5N6E5S9   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
8-29IIDTPQKPKRSRGSRWKHGVVPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025783  Set9_fungi  
IPR039977  Suv4-20/Set9  
Gene Ontology GO:0042799  F:histone H4K20 methyltransferase activity  
GO:0034770  P:histone H4-K20 methylation  
PROSITE View protein in PROSITE  
PS51567  SAM_MT43_SUVAR420_1  
Amino Acid Sequences MLSGSSEIIDTPQKPKRSRGSRWKHGVVPSVEEESHRVRVPGDYTKTSKLLAQAYDRWVDCHTCNVWFVQHNSYLTRRECPRCERHSMLYGFRWPKTDKEGSRDDEERVMDHRTVHRFLYPEEEARISRKDRGASFGVTPTPELSEPRTETEDSEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.49
3 0.57
4 0.63
5 0.71
6 0.75
7 0.78
8 0.81
9 0.87
10 0.85
11 0.8
12 0.75
13 0.72
14 0.63
15 0.57
16 0.49
17 0.43
18 0.37
19 0.31
20 0.29
21 0.25
22 0.27
23 0.22
24 0.2
25 0.17
26 0.19
27 0.23
28 0.27
29 0.29
30 0.3
31 0.33
32 0.36
33 0.36
34 0.34
35 0.32
36 0.28
37 0.26
38 0.23
39 0.24
40 0.24
41 0.26
42 0.28
43 0.27
44 0.24
45 0.22
46 0.22
47 0.18
48 0.19
49 0.17
50 0.15
51 0.15
52 0.15
53 0.16
54 0.15
55 0.17
56 0.16
57 0.17
58 0.17
59 0.19
60 0.21
61 0.23
62 0.22
63 0.25
64 0.29
65 0.31
66 0.35
67 0.4
68 0.47
69 0.47
70 0.53
71 0.51
72 0.49
73 0.51
74 0.49
75 0.44
76 0.38
77 0.4
78 0.36
79 0.34
80 0.34
81 0.28
82 0.28
83 0.32
84 0.38
85 0.33
86 0.36
87 0.41
88 0.42
89 0.46
90 0.45
91 0.4
92 0.35
93 0.33
94 0.28
95 0.24
96 0.23
97 0.18
98 0.19
99 0.24
100 0.25
101 0.26
102 0.26
103 0.27
104 0.26
105 0.25
106 0.3
107 0.27
108 0.25
109 0.25
110 0.26
111 0.25
112 0.27
113 0.31
114 0.26
115 0.29
116 0.32
117 0.35
118 0.34
119 0.38
120 0.38
121 0.36
122 0.36
123 0.33
124 0.31
125 0.27
126 0.26
127 0.21
128 0.21
129 0.2
130 0.2
131 0.2
132 0.25
133 0.27
134 0.3
135 0.33
136 0.31