Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6EL88

Protein Details
Accession A0A5N6EL88   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MGQRHNRRRTRPRSRNRSANHSPIEHydrophilic
NLS Segment(s)
PositionSequence
7-15RRRTRPRSR
Subcellular Location(s) mito 19, cyto 5.5, cyto_nucl 4.5
Family & Domain DBs
Amino Acid Sequences MGQRHNRRRTRPRSRNRSANHSPIELPPYNVNYTRSPAVPKTTTAACDLLDSISIPFAPTWHYGYTTWQKRDRTLRLEALRLEAEQCRLFGGEPGDDVGLCYRMLEYFGGLDYIDSLQSSKLLPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.93
3 0.88
4 0.87
5 0.84
6 0.82
7 0.75
8 0.67
9 0.59
10 0.52
11 0.52
12 0.43
13 0.37
14 0.31
15 0.3
16 0.3
17 0.3
18 0.31
19 0.26
20 0.29
21 0.28
22 0.26
23 0.26
24 0.25
25 0.29
26 0.27
27 0.26
28 0.25
29 0.25
30 0.25
31 0.23
32 0.22
33 0.16
34 0.15
35 0.14
36 0.11
37 0.09
38 0.08
39 0.06
40 0.05
41 0.05
42 0.05
43 0.04
44 0.04
45 0.06
46 0.08
47 0.1
48 0.1
49 0.12
50 0.12
51 0.17
52 0.26
53 0.31
54 0.35
55 0.38
56 0.39
57 0.44
58 0.52
59 0.52
60 0.48
61 0.47
62 0.5
63 0.46
64 0.48
65 0.43
66 0.38
67 0.32
68 0.27
69 0.24
70 0.17
71 0.17
72 0.15
73 0.14
74 0.12
75 0.12
76 0.12
77 0.12
78 0.13
79 0.1
80 0.1
81 0.11
82 0.11
83 0.1
84 0.1
85 0.09
86 0.08
87 0.08
88 0.08
89 0.07
90 0.07
91 0.08
92 0.08
93 0.08
94 0.07
95 0.08
96 0.08
97 0.08
98 0.07
99 0.07
100 0.08
101 0.07
102 0.07
103 0.07
104 0.07
105 0.09