Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179USH8

Protein Details
Accession A0A179USH8    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
60-84LTDSRMSRKLRRRYKRSYPPKGVLDHydrophilic
NLS Segment(s)
PositionSequence
67-75RKLRRRYKR
Subcellular Location(s) mito 10, cyto 6, nucl 5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
PROSITE View protein in PROSITE  
PS50088  ANK_REPEAT  
Amino Acid Sequences MNSAVSGSVAVEIWRFDAHVLSVYLLRPLFWDLARSLMPKARMYRARAMKPLCGATFIYLTDSRMSRKLRRRYKRSYPPKGVLDRALTAASYENDVDLLKILLAKGANVDHEDMFFGNALYTAIFLKNIEATTLLSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.09
5 0.09
6 0.11
7 0.11
8 0.11
9 0.12
10 0.12
11 0.15
12 0.14
13 0.13
14 0.12
15 0.13
16 0.14
17 0.13
18 0.15
19 0.12
20 0.15
21 0.17
22 0.17
23 0.17
24 0.18
25 0.21
26 0.23
27 0.26
28 0.31
29 0.35
30 0.39
31 0.46
32 0.51
33 0.53
34 0.55
35 0.54
36 0.49
37 0.46
38 0.44
39 0.35
40 0.29
41 0.24
42 0.19
43 0.17
44 0.14
45 0.14
46 0.12
47 0.12
48 0.12
49 0.13
50 0.13
51 0.17
52 0.21
53 0.26
54 0.36
55 0.45
56 0.54
57 0.64
58 0.71
59 0.75
60 0.82
61 0.85
62 0.87
63 0.87
64 0.85
65 0.81
66 0.8
67 0.75
68 0.66
69 0.58
70 0.5
71 0.4
72 0.33
73 0.26
74 0.19
75 0.15
76 0.14
77 0.11
78 0.1
79 0.09
80 0.07
81 0.07
82 0.08
83 0.07
84 0.06
85 0.06
86 0.05
87 0.05
88 0.05
89 0.07
90 0.07
91 0.07
92 0.08
93 0.09
94 0.1
95 0.11
96 0.13
97 0.11
98 0.11
99 0.12
100 0.11
101 0.11
102 0.09
103 0.08
104 0.06
105 0.06
106 0.06
107 0.05
108 0.06
109 0.06
110 0.07
111 0.08
112 0.08
113 0.09
114 0.11
115 0.11
116 0.12
117 0.11