Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179UPY8

Protein Details
Accession A0A179UPY8    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
31-53VCRRYQSTFRRLKQRLRVKPDASHydrophilic
182-204AIKSRWGKKRTIAREDRQLRKELHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR024388  Ribosomal_L20_mt  
Gene Ontology GO:0005840  C:ribosome  
KEGG bgh:BDBG_05079  -  
Pfam View protein in Pfam  
PF12824  MRP-L20  
Amino Acid Sequences MACPVTYSRRNVLMLPFLLPSWSESATSALVCRRYQSTFRRLKQRLRVKPDASFSPLPPNSPERIIYNPPSSAPSVYHTPTKFLPPNDVRRKLRAASFPGDPLQQQQQQHSRLPLVLRHKSQTKNILGEQEIAEMRQLRLEDPMKWSRYALAQRFGCSSHFVMQVCDAGPQKKAIQQQVLEAIKSRWGKKRTIAREDRQLRKELWARDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.32
3 0.29
4 0.23
5 0.22
6 0.2
7 0.17
8 0.14
9 0.14
10 0.13
11 0.13
12 0.15
13 0.15
14 0.15
15 0.15
16 0.16
17 0.19
18 0.19
19 0.21
20 0.22
21 0.25
22 0.33
23 0.39
24 0.46
25 0.52
26 0.59
27 0.68
28 0.71
29 0.76
30 0.79
31 0.81
32 0.81
33 0.8
34 0.83
35 0.75
36 0.74
37 0.7
38 0.63
39 0.59
40 0.52
41 0.43
42 0.44
43 0.41
44 0.36
45 0.35
46 0.34
47 0.3
48 0.29
49 0.3
50 0.23
51 0.27
52 0.3
53 0.32
54 0.31
55 0.29
56 0.28
57 0.28
58 0.26
59 0.22
60 0.18
61 0.17
62 0.18
63 0.19
64 0.24
65 0.22
66 0.23
67 0.24
68 0.29
69 0.3
70 0.26
71 0.34
72 0.34
73 0.45
74 0.52
75 0.6
76 0.56
77 0.56
78 0.59
79 0.52
80 0.51
81 0.46
82 0.41
83 0.35
84 0.33
85 0.31
86 0.28
87 0.26
88 0.22
89 0.18
90 0.18
91 0.19
92 0.19
93 0.22
94 0.27
95 0.3
96 0.32
97 0.31
98 0.27
99 0.25
100 0.25
101 0.25
102 0.27
103 0.29
104 0.29
105 0.31
106 0.37
107 0.38
108 0.42
109 0.45
110 0.41
111 0.4
112 0.39
113 0.39
114 0.33
115 0.32
116 0.27
117 0.22
118 0.18
119 0.14
120 0.14
121 0.12
122 0.11
123 0.11
124 0.11
125 0.09
126 0.15
127 0.17
128 0.17
129 0.23
130 0.3
131 0.3
132 0.3
133 0.3
134 0.25
135 0.3
136 0.37
137 0.35
138 0.37
139 0.36
140 0.37
141 0.38
142 0.38
143 0.32
144 0.27
145 0.25
146 0.21
147 0.23
148 0.22
149 0.22
150 0.22
151 0.22
152 0.19
153 0.2
154 0.18
155 0.17
156 0.17
157 0.19
158 0.2
159 0.24
160 0.3
161 0.33
162 0.37
163 0.36
164 0.39
165 0.45
166 0.45
167 0.4
168 0.36
169 0.3
170 0.31
171 0.35
172 0.38
173 0.38
174 0.4
175 0.44
176 0.51
177 0.61
178 0.64
179 0.7
180 0.74
181 0.73
182 0.8
183 0.85
184 0.86
185 0.8
186 0.75
187 0.65
188 0.65
189 0.64