Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6E8T0

Protein Details
Accession A0A5N6E8T0   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MRSFGIKSTQPRRKPRPPRPPPYVEQTHydrophilic
NLS Segment(s)
PositionSequence
12-19RRKPRPPR
Subcellular Location(s) nucl 16, cyto_nucl 11.833, mito_nucl 10.833, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MRSFGIKSTQPRRKPRPPRPPPYVEQTPYSCSTSMISNSHERRDDIDPVLKEELSSIYTDVPGFEEALFGGVKDLEKAGTAVFHRFIEGMILLQGNSWLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.9
3 0.9
4 0.91
5 0.92
6 0.9
7 0.88
8 0.81
9 0.79
10 0.77
11 0.68
12 0.62
13 0.55
14 0.5
15 0.45
16 0.42
17 0.33
18 0.25
19 0.23
20 0.21
21 0.21
22 0.18
23 0.18
24 0.24
25 0.26
26 0.29
27 0.3
28 0.28
29 0.29
30 0.3
31 0.3
32 0.24
33 0.27
34 0.24
35 0.25
36 0.25
37 0.21
38 0.18
39 0.15
40 0.14
41 0.09
42 0.09
43 0.07
44 0.06
45 0.07
46 0.07
47 0.07
48 0.07
49 0.07
50 0.07
51 0.06
52 0.06
53 0.06
54 0.07
55 0.07
56 0.05
57 0.05
58 0.05
59 0.05
60 0.06
61 0.06
62 0.05
63 0.06
64 0.06
65 0.06
66 0.09
67 0.1
68 0.12
69 0.14
70 0.14
71 0.15
72 0.14
73 0.14
74 0.13
75 0.12
76 0.1
77 0.09
78 0.1
79 0.09
80 0.09