Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6E6R8

Protein Details
Accession A0A5N6E6R8    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
82-108IHNEYKGKQRPARERRNGRSRNDPASRBasic
NLS Segment(s)
PositionSequence
88-102GKQRPARERRNGRSR
Subcellular Location(s) nucl 21.5, cyto_nucl 13, mito 2, pero 2
Family & Domain DBs
Amino Acid Sequences MAADLPLSKDITDAQGARNAQQAVVQTYVNLVDLLQSIRAGSPVEAFSTLEDLRAYTIENGRYFPKEEAYEGGLLRFLLREIHNEYKGKQRPARERRNGRSRNDPASRNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.21
3 0.22
4 0.22
5 0.26
6 0.24
7 0.2
8 0.21
9 0.21
10 0.18
11 0.19
12 0.18
13 0.13
14 0.13
15 0.13
16 0.11
17 0.09
18 0.06
19 0.05
20 0.06
21 0.07
22 0.06
23 0.06
24 0.06
25 0.06
26 0.07
27 0.06
28 0.06
29 0.07
30 0.07
31 0.08
32 0.08
33 0.08
34 0.08
35 0.1
36 0.1
37 0.09
38 0.08
39 0.08
40 0.07
41 0.07
42 0.08
43 0.06
44 0.09
45 0.11
46 0.12
47 0.13
48 0.14
49 0.16
50 0.17
51 0.17
52 0.17
53 0.16
54 0.16
55 0.17
56 0.17
57 0.17
58 0.15
59 0.15
60 0.12
61 0.11
62 0.1
63 0.08
64 0.07
65 0.08
66 0.09
67 0.13
68 0.19
69 0.26
70 0.3
71 0.32
72 0.34
73 0.41
74 0.47
75 0.52
76 0.5
77 0.54
78 0.6
79 0.69
80 0.79
81 0.79
82 0.83
83 0.85
84 0.91
85 0.9
86 0.85
87 0.86
88 0.82
89 0.81
90 0.78