Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6E679

Protein Details
Accession A0A5N6E679    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-41MSKNVKKSSCIKKRYSESSRAKSQQRQRRKRSLFKKAAEFSHydrophilic
NLS Segment(s)
PositionSequence
20-35RAKSQQRQRRKRSLFK
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MSKNVKKSSCIKKRYSESSRAKSQQRQRRKRSLFKKAAEFSLECESDVVVAIRIRKTGQAYIFDSSSQEAWLKTLPSLVCTVIVRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.77
4 0.77
5 0.76
6 0.79
7 0.76
8 0.76
9 0.74
10 0.77
11 0.77
12 0.78
13 0.81
14 0.8
15 0.85
16 0.86
17 0.88
18 0.88
19 0.89
20 0.87
21 0.82
22 0.81
23 0.72
24 0.65
25 0.58
26 0.47
27 0.39
28 0.34
29 0.28
30 0.19
31 0.17
32 0.14
33 0.11
34 0.11
35 0.08
36 0.05
37 0.06
38 0.08
39 0.09
40 0.1
41 0.1
42 0.13
43 0.15
44 0.18
45 0.2
46 0.23
47 0.25
48 0.27
49 0.27
50 0.25
51 0.23
52 0.2
53 0.17
54 0.14
55 0.12
56 0.1
57 0.11
58 0.13
59 0.13
60 0.12
61 0.17
62 0.15
63 0.16
64 0.18
65 0.17
66 0.18