Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6EKK2

Protein Details
Accession A0A5N6EKK2    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
34-60LFGLVNKRRTKRQKEEKRKKRGSTTHIBasic
NLS Segment(s)
PositionSequence
40-55KRRTKRQKEEKRKKRG
Subcellular Location(s) mito 16, nucl 8, cyto 1, plas 1, E.R. 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRFFFWNTLSKATSHTSVLYLLYHCFALLYVQHLFGLVNKRRTKRQKEEKRKKRGSTTHIPSNTQVCRLGNSSRWLELSSDLCKIQYCIFLPSCALH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.19
4 0.19
5 0.19
6 0.17
7 0.14
8 0.13
9 0.12
10 0.11
11 0.1
12 0.09
13 0.08
14 0.07
15 0.07
16 0.09
17 0.09
18 0.09
19 0.09
20 0.09
21 0.09
22 0.11
23 0.2
24 0.21
25 0.29
26 0.34
27 0.37
28 0.47
29 0.57
30 0.63
31 0.65
32 0.72
33 0.75
34 0.82
35 0.9
36 0.91
37 0.93
38 0.92
39 0.87
40 0.86
41 0.82
42 0.79
43 0.78
44 0.75
45 0.73
46 0.67
47 0.63
48 0.55
49 0.53
50 0.46
51 0.38
52 0.33
53 0.24
54 0.23
55 0.25
56 0.26
57 0.24
58 0.28
59 0.28
60 0.27
61 0.27
62 0.26
63 0.24
64 0.24
65 0.23
66 0.2
67 0.21
68 0.19
69 0.19
70 0.19
71 0.2
72 0.19
73 0.2
74 0.2
75 0.23
76 0.24
77 0.25