Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6F6M2

Protein Details
Accession A0A5N6F6M2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
10-33YARNDKSWLPGRKRKRNCVQYAIAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, plas 7, E.R. 3, golg 3, cyto 2.5, extr 2, cyto_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MWLIVRSLAYARNDKSWLPGRKRKRNCVQYAIATTSGCFMSVLLAVVTADWSELVLKDFREDCFATDID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.4
4 0.45
5 0.48
6 0.55
7 0.62
8 0.71
9 0.8
10 0.83
11 0.85
12 0.86
13 0.83
14 0.81
15 0.75
16 0.69
17 0.63
18 0.55
19 0.46
20 0.35
21 0.28
22 0.22
23 0.17
24 0.12
25 0.08
26 0.05
27 0.05
28 0.05
29 0.06
30 0.04
31 0.05
32 0.04
33 0.04
34 0.04
35 0.04
36 0.03
37 0.03
38 0.03
39 0.04
40 0.04
41 0.07
42 0.08
43 0.09
44 0.13
45 0.14
46 0.15
47 0.2
48 0.2
49 0.2