Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6E8H4

Protein Details
Accession A0A5N6E8H4    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MPQKPLLKKQRRSESTKAKTQQRNRLKKSLFHydrophilic
NLS Segment(s)
PositionSequence
8-33KKQRRSESTKAKTQQRNRLKKSLFRK
Subcellular Location(s) nucl 16.5, mito_nucl 13, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MPQKPLLKKQRRSESTKAKTQQRNRLKKSLFRKAAKYSIECESDVFVMIRIRKNGQRFTFDSSALDHWLPSMPELARRFDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.82
3 0.82
4 0.8
5 0.78
6 0.81
7 0.82
8 0.82
9 0.82
10 0.84
11 0.81
12 0.83
13 0.78
14 0.76
15 0.77
16 0.77
17 0.75
18 0.69
19 0.69
20 0.65
21 0.67
22 0.62
23 0.54
24 0.46
25 0.4
26 0.38
27 0.31
28 0.26
29 0.19
30 0.16
31 0.15
32 0.12
33 0.09
34 0.09
35 0.12
36 0.14
37 0.15
38 0.19
39 0.23
40 0.29
41 0.36
42 0.37
43 0.41
44 0.41
45 0.47
46 0.46
47 0.42
48 0.37
49 0.31
50 0.29
51 0.26
52 0.24
53 0.15
54 0.14
55 0.15
56 0.15
57 0.13
58 0.16
59 0.13
60 0.21
61 0.23