Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6E650

Protein Details
Accession A0A5N6E650    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-35MTTKTRTIRRRRSDSAKSRCQQRNRRKIQLFLKAYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MTTKTRTIRRRRSDSAKSRCQQRNRRKIQLFLKAYEYCQECDADISLTIRLRHSGEIVFFNSDGAWTPLKEQLSTYYPRPKQITWQELAARYNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.87
3 0.87
4 0.82
5 0.84
6 0.83
7 0.83
8 0.83
9 0.84
10 0.85
11 0.83
12 0.88
13 0.82
14 0.83
15 0.81
16 0.8
17 0.73
18 0.64
19 0.61
20 0.51
21 0.46
22 0.43
23 0.35
24 0.26
25 0.23
26 0.21
27 0.14
28 0.14
29 0.14
30 0.09
31 0.08
32 0.08
33 0.08
34 0.09
35 0.1
36 0.09
37 0.1
38 0.11
39 0.11
40 0.11
41 0.11
42 0.11
43 0.13
44 0.14
45 0.13
46 0.12
47 0.12
48 0.11
49 0.1
50 0.09
51 0.09
52 0.09
53 0.08
54 0.1
55 0.14
56 0.15
57 0.15
58 0.15
59 0.18
60 0.21
61 0.25
62 0.29
63 0.36
64 0.37
65 0.44
66 0.48
67 0.44
68 0.5
69 0.57
70 0.58
71 0.51
72 0.56
73 0.54
74 0.54