Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6F7R2

Protein Details
Accession A0A5N6F7R2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
70-90EPSGGSGEKEKKKKDKKKGKABasic
NLS Segment(s)
PositionSequence
76-90GEKEKKKKDKKKGKA
Subcellular Location(s) mito 19, cyto 6
Family & Domain DBs
Amino Acid Sequences MPEKLPPAPPAPRGWKIGTILPIHSPAYSGGGVSDNPLKDAMAEMQNMQGMPGMPQIPGMPGLAAMMGGEPSGGSGEKEKKKKDKKKGKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.47
3 0.43
4 0.44
5 0.41
6 0.35
7 0.32
8 0.29
9 0.29
10 0.25
11 0.22
12 0.18
13 0.14
14 0.14
15 0.13
16 0.11
17 0.09
18 0.09
19 0.09
20 0.1
21 0.13
22 0.1
23 0.11
24 0.11
25 0.1
26 0.09
27 0.1
28 0.1
29 0.08
30 0.09
31 0.08
32 0.09
33 0.1
34 0.09
35 0.09
36 0.07
37 0.06
38 0.06
39 0.08
40 0.08
41 0.07
42 0.08
43 0.08
44 0.08
45 0.08
46 0.08
47 0.06
48 0.05
49 0.05
50 0.05
51 0.04
52 0.04
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.04
60 0.04
61 0.05
62 0.11
63 0.21
64 0.29
65 0.38
66 0.46
67 0.56
68 0.68
69 0.77
70 0.83