Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q754N8

Protein Details
Accession Q754N8    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-31VNVPKTRKTYCKGKACRKHTQHKVTQYKAGHydrophilic
NLS Segment(s)
PositionSequence
60-61KK
Subcellular Location(s) nucl 12.5, cyto_nucl 9.5, mito 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ago:AGOS_AFR034W  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRKTYCKGKACRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGFGGQTKQIFRKKAKTTKKVVLRLECLSCKTKAQLPLKRCKHFELGGEKKQKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.83
4 0.88
5 0.87
6 0.88
7 0.87
8 0.87
9 0.85
10 0.85
11 0.87
12 0.8
13 0.8
14 0.74
15 0.69
16 0.62
17 0.56
18 0.45
19 0.37
20 0.35
21 0.34
22 0.33
23 0.29
24 0.34
25 0.38
26 0.42
27 0.47
28 0.52
29 0.49
30 0.55
31 0.63
32 0.6
33 0.61
34 0.59
35 0.58
36 0.56
37 0.54
38 0.47
39 0.4
40 0.39
41 0.32
42 0.36
43 0.35
44 0.35
45 0.36
46 0.42
47 0.49
48 0.55
49 0.63
50 0.65
51 0.68
52 0.72
53 0.77
54 0.76
55 0.74
56 0.7
57 0.64
58 0.59
59 0.56
60 0.5
61 0.44
62 0.39
63 0.34
64 0.3
65 0.28
66 0.29
67 0.34
68 0.42
69 0.46
70 0.5
71 0.6
72 0.68
73 0.73
74 0.71
75 0.66
76 0.64
77 0.59
78 0.59
79 0.59
80 0.59
81 0.61
82 0.66
83 0.62
84 0.6
85 0.61
86 0.57