FuNGI

Q754N5

Protein Details

Accession

Q754N5

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
196-219	ILDSRRGRRARRPRKFRPHSVTMV	Basic

NLS Segment(s)

Position	Sequence
200-212	RRGRRARRPRKFR

Subcellular Location(s)

plas 20, E.R. 3, mito 2, vacu 2

Family & Domain DBs

InterPro	View protein in InterPro IPR029020 Ammonium/urea_transptr IPR001905 Ammonium_transpt IPR024041 NH4_transpt_AmtB-like_dom
Gene Ontology	GO:0005886 C:plasma membrane GO:0008519 F:ammonium transmembrane transporter activity GO:0072488 P:ammonium transmembrane transport GO:0019740 P:nitrogen utilization GO:1900430 P:positive regulation of filamentous growth of a population of unicellular organisms GO:0007124 P:pseudohyphal growth
KEGG	ago:AGOS_AFR037W -
Pfam	View protein in Pfam PF00909 Ammonium_transp

Amino Acid Sequences

MPGNQVGTDGAGAVDVAALANAAWVGASSVLIWMMVPGAGLLYAGLSRRRHALAMLWASIMAVTVVSLQWFAWGYTLAFAPATRGNGFLGTLHYAGMYHVLDAAPKRALPTAADVLFQGMFAMVAGTLMIGGSGGHARLLPMLVFLFWWVTLVYCPVACWTWNADGWLARMGVLDYAGGGPVHLTSGHAALVYALILDSRRGRRARRPRKFRPHSVTMVVLGTVFMWFGWFGFNGGTAGSPTALAFYGCVSSNLAAGCGAIVWLFLDYFRYGKKWTVVGLCSGAISGLVAITPAAGYVPAWASVAIGAFAGFSCNFAVAIKIVLGIDDGLDVYAIHGVGGAVGSAMTGLFACKYVNASGAPYVRPIEGGWLERNWAQLGYQVVAILSISAWSAIVTALLLLLLDRIPYLRLRPAADEQEDVDIHGINLFDNDVHDRVAEKIGVTSHAASTSRDQEAAKPRETPELDAVVS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.05
2	0.04
3	0.03
4	0.03
5	0.03
6	0.03
7	0.03
8	0.03
9	0.03
10	0.03
11	0.03
12	0.04
13	0.04
14	0.04
15	0.04
16	0.05
17	0.05
18	0.05
19	0.05
20	0.05
21	0.05
22	0.05
23	0.04
24	0.04
25	0.04
26	0.04
27	0.04
28	0.04
29	0.04
30	0.05
31	0.07
32	0.14
33	0.15
34	0.17
35	0.21
36	0.23
37	0.23
38	0.24
39	0.27
40	0.3
41	0.33
42	0.32
43	0.28
44	0.26
45	0.25
46	0.24
47	0.18
48	0.09
49	0.05
50	0.04
51	0.04
52	0.04
53	0.05
54	0.05
55	0.05
56	0.07
57	0.08
58	0.08
59	0.08
60	0.09
61	0.09
62	0.1
63	0.1
64	0.09
65	0.09
66	0.08
67	0.11
68	0.12
69	0.15
70	0.14
71	0.14
72	0.15
73	0.15
74	0.15
75	0.13
76	0.13
77	0.12
78	0.12
79	0.11
80	0.1
81	0.1
82	0.1
83	0.12
84	0.1
85	0.07
86	0.08
87	0.08
88	0.1
89	0.11
90	0.14
91	0.12
92	0.12
93	0.13
94	0.14
95	0.15
96	0.14
97	0.19
98	0.22
99	0.21
100	0.21
101	0.2
102	0.19
103	0.18
104	0.17
105	0.11
106	0.06
107	0.05
108	0.04
109	0.05
110	0.03
111	0.03
112	0.03
113	0.02
114	0.02
115	0.02
116	0.02
117	0.02
118	0.02
119	0.03
120	0.04
121	0.04
122	0.04
123	0.04
124	0.05
125	0.05
126	0.06
127	0.05
128	0.05
129	0.06
130	0.05
131	0.05
132	0.06
133	0.05
134	0.05
135	0.05
136	0.05
137	0.05
138	0.05
139	0.06
140	0.07
141	0.06
142	0.06
143	0.07
144	0.08
145	0.08
146	0.09
147	0.11
148	0.13
149	0.14
150	0.15
151	0.14
152	0.15
153	0.15
154	0.16
155	0.13
156	0.1
157	0.1
158	0.09
159	0.08
160	0.07
161	0.06
162	0.04
163	0.04
164	0.04
165	0.04
166	0.03
167	0.03
168	0.03
169	0.04
170	0.04
171	0.04
172	0.04
173	0.05
174	0.05
175	0.05
176	0.05
177	0.05
178	0.05
179	0.04
180	0.03
181	0.03
182	0.03
183	0.03
184	0.05
185	0.09
186	0.11
187	0.18
188	0.21
189	0.26
190	0.36
191	0.48
192	0.58
193	0.64
194	0.73
195	0.78
196	0.86
197	0.9
198	0.9
199	0.87
200	0.82
201	0.76
202	0.68
203	0.57
204	0.47
205	0.38
206	0.28
207	0.2
208	0.13
209	0.08
210	0.06
211	0.04
212	0.03
213	0.03
214	0.03
215	0.03
216	0.04
217	0.03
218	0.04
219	0.04
220	0.04
221	0.04
222	0.04
223	0.04
224	0.04
225	0.04
226	0.04
227	0.04
228	0.04
229	0.04
230	0.04
231	0.04
232	0.04
233	0.04
234	0.05
235	0.05
236	0.06
237	0.06
238	0.06
239	0.07
240	0.07
241	0.07
242	0.05
243	0.05
244	0.05
245	0.04
246	0.04
247	0.02
248	0.02
249	0.02
250	0.03
251	0.03
252	0.03
253	0.04
254	0.05
255	0.06
256	0.07
257	0.08
258	0.09
259	0.12
260	0.14
261	0.14
262	0.17
263	0.19
264	0.19
265	0.19
266	0.19
267	0.17
268	0.14
269	0.13
270	0.1
271	0.06
272	0.05
273	0.04
274	0.02
275	0.02
276	0.02
277	0.02
278	0.02
279	0.02
280	0.02
281	0.02
282	0.02
283	0.02
284	0.03
285	0.04
286	0.04
287	0.05
288	0.05
289	0.05
290	0.05
291	0.05
292	0.05
293	0.04
294	0.04
295	0.03
296	0.03
297	0.05
298	0.04
299	0.05
300	0.05
301	0.05
302	0.06
303	0.06
304	0.06
305	0.05
306	0.06
307	0.05
308	0.06
309	0.05
310	0.05
311	0.05
312	0.04
313	0.04
314	0.04
315	0.04
316	0.03
317	0.03
318	0.03
319	0.03
320	0.04
321	0.04
322	0.04
323	0.04
324	0.04
325	0.04
326	0.04
327	0.03
328	0.02
329	0.02
330	0.02
331	0.02
332	0.02
333	0.02
334	0.02
335	0.03
336	0.03
337	0.04
338	0.04
339	0.05
340	0.07
341	0.08
342	0.1
343	0.1
344	0.11
345	0.15
346	0.17
347	0.17
348	0.17
349	0.18
350	0.16
351	0.16
352	0.15
353	0.16
354	0.17
355	0.19
356	0.2
357	0.19
358	0.21
359	0.21
360	0.23
361	0.18
362	0.16
363	0.13
364	0.14
365	0.15
366	0.14
367	0.13
368	0.12
369	0.11
370	0.1
371	0.1
372	0.07
373	0.05
374	0.04
375	0.04
376	0.04
377	0.04
378	0.04
379	0.04
380	0.04
381	0.04
382	0.04
383	0.04
384	0.03
385	0.03
386	0.03
387	0.03
388	0.04
389	0.04
390	0.04
391	0.04
392	0.05
393	0.07
394	0.09
395	0.12
396	0.17
397	0.21
398	0.23
399	0.28
400	0.34
401	0.4
402	0.4
403	0.39
404	0.34
405	0.35
406	0.33
407	0.28
408	0.22
409	0.15
410	0.13
411	0.13
412	0.12
413	0.07
414	0.08
415	0.08
416	0.07
417	0.09
418	0.12
419	0.12
420	0.12
421	0.12
422	0.13
423	0.15
424	0.18
425	0.16
426	0.13
427	0.15
428	0.16
429	0.17
430	0.19
431	0.18
432	0.16
433	0.19
434	0.2
435	0.2
436	0.24
437	0.28
438	0.28
439	0.29
440	0.28
441	0.33
442	0.42
443	0.46
444	0.44
445	0.43
446	0.43
447	0.5
448	0.51
449	0.48
450	0.43

Q754N5

3D AlphaFold-predicted Structure Viewer