Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q754N5

Protein Details
Accession Q754N5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
196-219ILDSRRGRRARRPRKFRPHSVTMVBasic
NLS Segment(s)
PositionSequence
200-212RRGRRARRPRKFR
Subcellular Location(s) plas 20, E.R. 3, mito 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029020  Ammonium/urea_transptr  
IPR001905  Ammonium_transpt  
IPR024041  NH4_transpt_AmtB-like_dom  
Gene Ontology GO:0005886  C:plasma membrane  
GO:0008519  F:ammonium transmembrane transporter activity  
GO:0072488  P:ammonium transmembrane transport  
GO:0019740  P:nitrogen utilization  
GO:1900430  P:positive regulation of filamentous growth of a population of unicellular organisms  
GO:0007124  P:pseudohyphal growth  
KEGG ago:AGOS_AFR037W  -  
Pfam View protein in Pfam  
PF00909  Ammonium_transp  
Amino Acid Sequences MPGNQVGTDGAGAVDVAALANAAWVGASSVLIWMMVPGAGLLYAGLSRRRHALAMLWASIMAVTVVSLQWFAWGYTLAFAPATRGNGFLGTLHYAGMYHVLDAAPKRALPTAADVLFQGMFAMVAGTLMIGGSGGHARLLPMLVFLFWWVTLVYCPVACWTWNADGWLARMGVLDYAGGGPVHLTSGHAALVYALILDSRRGRRARRPRKFRPHSVTMVVLGTVFMWFGWFGFNGGTAGSPTALAFYGCVSSNLAAGCGAIVWLFLDYFRYGKKWTVVGLCSGAISGLVAITPAAGYVPAWASVAIGAFAGFSCNFAVAIKIVLGIDDGLDVYAIHGVGGAVGSAMTGLFACKYVNASGAPYVRPIEGGWLERNWAQLGYQVVAILSISAWSAIVTALLLLLLDRIPYLRLRPAADEQEDVDIHGINLFDNDVHDRVAEKIGVTSHAASTSRDQEAAKPRETPELDAVVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.03
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.03
10 0.03
11 0.03
12 0.04
13 0.04
14 0.04
15 0.04
16 0.05
17 0.05
18 0.05
19 0.05
20 0.05
21 0.05
22 0.05
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.05
31 0.07
32 0.14
33 0.15
34 0.17
35 0.21
36 0.23
37 0.23
38 0.24
39 0.27
40 0.3
41 0.33
42 0.32
43 0.28
44 0.26
45 0.25
46 0.24
47 0.18
48 0.09
49 0.05
50 0.04
51 0.04
52 0.04
53 0.05
54 0.05
55 0.05
56 0.07
57 0.08
58 0.08
59 0.08
60 0.09
61 0.09
62 0.1
63 0.1
64 0.09
65 0.09
66 0.08
67 0.11
68 0.12
69 0.15
70 0.14
71 0.14
72 0.15
73 0.15
74 0.15
75 0.13
76 0.13
77 0.12
78 0.12
79 0.11
80 0.1
81 0.1
82 0.1
83 0.12
84 0.1
85 0.07
86 0.08
87 0.08
88 0.1
89 0.11
90 0.14
91 0.12
92 0.12
93 0.13
94 0.14
95 0.15
96 0.14
97 0.19
98 0.22
99 0.21
100 0.21
101 0.2
102 0.19
103 0.18
104 0.17
105 0.11
106 0.06
107 0.05
108 0.04
109 0.05
110 0.03
111 0.03
112 0.03
113 0.02
114 0.02
115 0.02
116 0.02
117 0.02
118 0.02
119 0.03
120 0.04
121 0.04
122 0.04
123 0.04
124 0.05
125 0.05
126 0.06
127 0.05
128 0.05
129 0.06
130 0.05
131 0.05
132 0.06
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.06
140 0.07
141 0.06
142 0.06
143 0.07
144 0.08
145 0.08
146 0.09
147 0.11
148 0.13
149 0.14
150 0.15
151 0.14
152 0.15
153 0.15
154 0.16
155 0.13
156 0.1
157 0.1
158 0.09
159 0.08
160 0.07
161 0.06
162 0.04
163 0.04
164 0.04
165 0.04
166 0.03
167 0.03
168 0.03
169 0.04
170 0.04
171 0.04
172 0.04
173 0.05
174 0.05
175 0.05
176 0.05
177 0.05
178 0.05
179 0.04
180 0.03
181 0.03
182 0.03
183 0.03
184 0.05
185 0.09
186 0.11
187 0.18
188 0.21
189 0.26
190 0.36
191 0.48
192 0.58
193 0.64
194 0.73
195 0.78
196 0.86
197 0.9
198 0.9
199 0.87
200 0.82
201 0.76
202 0.68
203 0.57
204 0.47
205 0.38
206 0.28
207 0.2
208 0.13
209 0.08
210 0.06
211 0.04
212 0.03
213 0.03
214 0.03
215 0.03
216 0.04
217 0.03
218 0.04
219 0.04
220 0.04
221 0.04
222 0.04
223 0.04
224 0.04
225 0.04
226 0.04
227 0.04
228 0.04
229 0.04
230 0.04
231 0.04
232 0.04
233 0.04
234 0.05
235 0.05
236 0.06
237 0.06
238 0.06
239 0.07
240 0.07
241 0.07
242 0.05
243 0.05
244 0.05
245 0.04
246 0.04
247 0.02
248 0.02
249 0.02
250 0.03
251 0.03
252 0.03
253 0.04
254 0.05
255 0.06
256 0.07
257 0.08
258 0.09
259 0.12
260 0.14
261 0.14
262 0.17
263 0.19
264 0.19
265 0.19
266 0.19
267 0.17
268 0.14
269 0.13
270 0.1
271 0.06
272 0.05
273 0.04
274 0.02
275 0.02
276 0.02
277 0.02
278 0.02
279 0.02
280 0.02
281 0.02
282 0.02
283 0.02
284 0.03
285 0.04
286 0.04
287 0.05
288 0.05
289 0.05
290 0.05
291 0.05
292 0.05
293 0.04
294 0.04
295 0.03
296 0.03
297 0.05
298 0.04
299 0.05
300 0.05
301 0.05
302 0.06
303 0.06
304 0.06
305 0.05
306 0.06
307 0.05
308 0.06
309 0.05
310 0.05
311 0.05
312 0.04
313 0.04
314 0.04
315 0.04
316 0.03
317 0.03
318 0.03
319 0.03
320 0.04
321 0.04
322 0.04
323 0.04
324 0.04
325 0.04
326 0.04
327 0.03
328 0.02
329 0.02
330 0.02
331 0.02
332 0.02
333 0.02
334 0.02
335 0.03
336 0.03
337 0.04
338 0.04
339 0.05
340 0.07
341 0.08
342 0.1
343 0.1
344 0.11
345 0.15
346 0.17
347 0.17
348 0.17
349 0.18
350 0.16
351 0.16
352 0.15
353 0.16
354 0.17
355 0.19
356 0.2
357 0.19
358 0.21
359 0.21
360 0.23
361 0.18
362 0.16
363 0.13
364 0.14
365 0.15
366 0.14
367 0.13
368 0.12
369 0.11
370 0.1
371 0.1
372 0.07
373 0.05
374 0.04
375 0.04
376 0.04
377 0.04
378 0.04
379 0.04
380 0.04
381 0.04
382 0.04
383 0.04
384 0.03
385 0.03
386 0.03
387 0.03
388 0.04
389 0.04
390 0.04
391 0.04
392 0.05
393 0.07
394 0.09
395 0.12
396 0.17
397 0.21
398 0.23
399 0.28
400 0.34
401 0.4
402 0.4
403 0.39
404 0.34
405 0.35
406 0.33
407 0.28
408 0.22
409 0.15
410 0.13
411 0.13
412 0.12
413 0.07
414 0.08
415 0.08
416 0.07
417 0.09
418 0.12
419 0.12
420 0.12
421 0.12
422 0.13
423 0.15
424 0.18
425 0.16
426 0.13
427 0.15
428 0.16
429 0.17
430 0.19
431 0.18
432 0.16
433 0.19
434 0.2
435 0.2
436 0.24
437 0.28
438 0.28
439 0.29
440 0.28
441 0.33
442 0.42
443 0.46
444 0.44
445 0.43
446 0.43
447 0.5
448 0.51
449 0.48
450 0.43