Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UV42

Protein Details
Accession A0A179UV42    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
149-168EIFQRQLKPRRPSRCCNQHSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024079  MetalloPept_cat_dom_sf  
IPR012962  Pept_M54_archaemetzincn  
Gene Ontology GO:0008237  F:metallopeptidase activity  
GO:0006508  P:proteolysis  
Amino Acid Sequences MTTFPSPLVLPGDDIALDADYPHQSFDSWLREEDRNETASRKNVVHVAAPPDIQPDVSFIYQWDTSQIKRDTSVPTLKVEDVLNSLETFYLGSPVKLQPNPIPVSFTSWESGGTRRGPKTKTKQEEPEYTRFNIEIECVRIRTRAAPDEIFQRQLKPRRPSRCCNQHSAQKCERTNIDKQNFYESADDTFVCGRAYGGSRVAVVSASRYNPILDGKHNVDCEQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.09
4 0.08
5 0.07
6 0.09
7 0.1
8 0.1
9 0.11
10 0.1
11 0.1
12 0.13
13 0.18
14 0.22
15 0.22
16 0.24
17 0.28
18 0.31
19 0.33
20 0.35
21 0.33
22 0.29
23 0.29
24 0.29
25 0.3
26 0.32
27 0.34
28 0.3
29 0.29
30 0.3
31 0.3
32 0.29
33 0.29
34 0.28
35 0.26
36 0.25
37 0.23
38 0.22
39 0.2
40 0.17
41 0.14
42 0.11
43 0.12
44 0.12
45 0.12
46 0.1
47 0.14
48 0.14
49 0.14
50 0.16
51 0.15
52 0.15
53 0.23
54 0.25
55 0.22
56 0.23
57 0.26
58 0.26
59 0.3
60 0.35
61 0.28
62 0.29
63 0.3
64 0.28
65 0.27
66 0.23
67 0.19
68 0.14
69 0.14
70 0.12
71 0.1
72 0.1
73 0.08
74 0.07
75 0.07
76 0.05
77 0.08
78 0.07
79 0.07
80 0.1
81 0.12
82 0.16
83 0.16
84 0.19
85 0.18
86 0.23
87 0.26
88 0.24
89 0.24
90 0.19
91 0.24
92 0.23
93 0.22
94 0.17
95 0.15
96 0.15
97 0.14
98 0.15
99 0.13
100 0.15
101 0.18
102 0.2
103 0.25
104 0.27
105 0.36
106 0.44
107 0.52
108 0.56
109 0.58
110 0.64
111 0.66
112 0.73
113 0.7
114 0.67
115 0.6
116 0.53
117 0.47
118 0.38
119 0.32
120 0.23
121 0.18
122 0.13
123 0.13
124 0.14
125 0.14
126 0.15
127 0.15
128 0.16
129 0.19
130 0.21
131 0.21
132 0.24
133 0.24
134 0.25
135 0.3
136 0.31
137 0.32
138 0.28
139 0.29
140 0.33
141 0.4
142 0.48
143 0.5
144 0.58
145 0.64
146 0.71
147 0.75
148 0.78
149 0.81
150 0.77
151 0.76
152 0.74
153 0.72
154 0.73
155 0.73
156 0.7
157 0.68
158 0.65
159 0.61
160 0.6
161 0.56
162 0.57
163 0.59
164 0.59
165 0.55
166 0.55
167 0.58
168 0.53
169 0.49
170 0.43
171 0.33
172 0.28
173 0.24
174 0.23
175 0.16
176 0.17
177 0.15
178 0.13
179 0.12
180 0.09
181 0.11
182 0.14
183 0.15
184 0.16
185 0.16
186 0.16
187 0.16
188 0.16
189 0.14
190 0.11
191 0.13
192 0.15
193 0.16
194 0.17
195 0.18
196 0.18
197 0.19
198 0.24
199 0.23
200 0.23
201 0.29
202 0.32
203 0.37
204 0.38