Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5X2G1

Protein Details
Accession A0A5N5X2G1    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
84-108SFCNQRIRRIMERRRRHLECRRKTGBasic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 9.833, cyto 8, cyto_mito 5.833, E.R. 3, mito 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
IPR001810  F-box_dom  
Pfam View protein in Pfam  
PF12937  F-box-like  
PROSITE View protein in PROSITE  
PS50181  FBOX  
Amino Acid Sequences MEQKGPQDMRDPSNYSLMNLPSELHIYISSYLPYPDALALKHTCRHFYSLVYTGVHLKVDWLVERFERKLECPMEKCSFRTDESFCNQRIRRIMERRRRHLECRRKTGGCSLLSPLEPRVCNSLCAFHLRLRVAVFLFIVGLTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.37
3 0.37
4 0.33
5 0.28
6 0.24
7 0.22
8 0.16
9 0.18
10 0.16
11 0.13
12 0.11
13 0.11
14 0.12
15 0.13
16 0.12
17 0.11
18 0.11
19 0.1
20 0.1
21 0.09
22 0.1
23 0.1
24 0.09
25 0.13
26 0.16
27 0.18
28 0.23
29 0.23
30 0.25
31 0.25
32 0.29
33 0.26
34 0.25
35 0.27
36 0.26
37 0.27
38 0.24
39 0.23
40 0.21
41 0.21
42 0.19
43 0.14
44 0.1
45 0.09
46 0.09
47 0.1
48 0.09
49 0.09
50 0.11
51 0.13
52 0.13
53 0.14
54 0.15
55 0.15
56 0.2
57 0.22
58 0.24
59 0.24
60 0.3
61 0.32
62 0.33
63 0.33
64 0.3
65 0.29
66 0.27
67 0.28
68 0.25
69 0.24
70 0.27
71 0.3
72 0.29
73 0.35
74 0.35
75 0.35
76 0.38
77 0.4
78 0.45
79 0.51
80 0.6
81 0.62
82 0.71
83 0.75
84 0.8
85 0.79
86 0.8
87 0.8
88 0.81
89 0.8
90 0.79
91 0.78
92 0.71
93 0.68
94 0.66
95 0.62
96 0.53
97 0.46
98 0.39
99 0.35
100 0.34
101 0.33
102 0.28
103 0.26
104 0.25
105 0.24
106 0.27
107 0.25
108 0.27
109 0.27
110 0.28
111 0.24
112 0.3
113 0.3
114 0.28
115 0.33
116 0.32
117 0.33
118 0.3
119 0.31
120 0.26
121 0.25
122 0.21
123 0.14
124 0.13