Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5X7X1

Protein Details
Accession A0A5N5X7X1    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTRGNQRDKAREKNQKLAAKHydrophilic
NLS Segment(s)
PositionSequence
16-21KLAAKK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007513  SERF-like_N  
Pfam View protein in Pfam  
PF04419  4F5  
Amino Acid Sequences MTRGNQRDKAREKNQKLAAKKKTATSLSGAAFQQKKEDDAEIMRRKQAANAAKKAAAGADAPKMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.79
4 0.79
5 0.76
6 0.74
7 0.7
8 0.64
9 0.62
10 0.56
11 0.49
12 0.42
13 0.38
14 0.31
15 0.31
16 0.27
17 0.25
18 0.24
19 0.22
20 0.22
21 0.18
22 0.18
23 0.16
24 0.17
25 0.13
26 0.15
27 0.25
28 0.29
29 0.3
30 0.31
31 0.31
32 0.31
33 0.32
34 0.36
35 0.36
36 0.37
37 0.42
38 0.44
39 0.43
40 0.43
41 0.41
42 0.33
43 0.26
44 0.19
45 0.16