Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5WTN0

Protein Details
Accession A0A5N5WTN0    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
55-74GSRSEAKRTRSKRETARKGPBasic
NLS Segment(s)
PositionSequence
58-74SEAKRTRSKRETARKGP
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MNHKPSDDMSGNNNGRIVKRPKRVLTPARKEQNRVAQRAYRECYTEGVGARPLIGSRSEAKRTRSKRETARKGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.36
4 0.4
5 0.39
6 0.47
7 0.54
8 0.57
9 0.63
10 0.71
11 0.73
12 0.75
13 0.75
14 0.76
15 0.77
16 0.75
17 0.71
18 0.67
19 0.67
20 0.62
21 0.55
22 0.49
23 0.43
24 0.44
25 0.46
26 0.43
27 0.34
28 0.3
29 0.28
30 0.26
31 0.24
32 0.23
33 0.18
34 0.16
35 0.16
36 0.14
37 0.14
38 0.12
39 0.1
40 0.09
41 0.09
42 0.1
43 0.15
44 0.21
45 0.29
46 0.34
47 0.4
48 0.49
49 0.55
50 0.63
51 0.65
52 0.68
53 0.72
54 0.78