Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5WZ32

Protein Details
Accession A0A5N5WZ32    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
40-62FMFACLSARKRRRRGQKPMYGTGHydrophilic
NLS Segment(s)
PositionSequence
48-55RKRRRRGQ
Subcellular Location(s) mito 13, plas 8, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR020999  Chitin_synth_reg_RCR  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF12273  RCR  
Amino Acid Sequences MATYCRDRWGRVYRCRASWHNWGRWVLLAVILVVAFIAFFMFACLSARKRRRRGQKPMYGTGWIGGQPPQQYQQQPYPNQAPPAPPGYQPSPGPGYETQYGHNQGFYGHQQYGTEPQQPPNAYARDGMYSPPPGPPPGNYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.73
3 0.7
4 0.65
5 0.67
6 0.66
7 0.63
8 0.63
9 0.6
10 0.54
11 0.5
12 0.45
13 0.34
14 0.26
15 0.18
16 0.12
17 0.1
18 0.09
19 0.07
20 0.05
21 0.04
22 0.03
23 0.02
24 0.02
25 0.02
26 0.02
27 0.03
28 0.03
29 0.04
30 0.06
31 0.08
32 0.11
33 0.21
34 0.3
35 0.39
36 0.48
37 0.56
38 0.66
39 0.74
40 0.83
41 0.84
42 0.85
43 0.83
44 0.8
45 0.73
46 0.63
47 0.53
48 0.42
49 0.32
50 0.23
51 0.16
52 0.11
53 0.11
54 0.1
55 0.11
56 0.13
57 0.16
58 0.17
59 0.19
60 0.26
61 0.31
62 0.31
63 0.35
64 0.38
65 0.36
66 0.37
67 0.35
68 0.29
69 0.25
70 0.27
71 0.24
72 0.19
73 0.22
74 0.22
75 0.24
76 0.23
77 0.24
78 0.23
79 0.21
80 0.24
81 0.21
82 0.23
83 0.24
84 0.24
85 0.23
86 0.25
87 0.29
88 0.25
89 0.24
90 0.2
91 0.16
92 0.19
93 0.2
94 0.19
95 0.16
96 0.16
97 0.16
98 0.18
99 0.24
100 0.25
101 0.29
102 0.26
103 0.29
104 0.35
105 0.36
106 0.37
107 0.37
108 0.36
109 0.3
110 0.31
111 0.29
112 0.25
113 0.25
114 0.24
115 0.22
116 0.24
117 0.23
118 0.26
119 0.26
120 0.27
121 0.28