Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5WXH0

Protein Details
Accession A0A5N5WXH0    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
4-31ASPTQSNRSKSVRKSKHQKQGRRKSSLMHydrophilic
NLS Segment(s)
PositionSequence
12-32SKSVRKSKHQKQGRRKSSLMK
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
Amino Acid Sequences MASASPTQSNRSKSVRKSKHQKQGRRKSSLMKKAAEYSKMCDADVCVGIRRRETGQVFILSADASGFWAFLSRTPTTQPQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.69
3 0.74
4 0.8
5 0.84
6 0.86
7 0.88
8 0.89
9 0.89
10 0.91
11 0.9
12 0.86
13 0.79
14 0.79
15 0.79
16 0.79
17 0.73
18 0.64
19 0.57
20 0.56
21 0.56
22 0.51
23 0.42
24 0.35
25 0.36
26 0.34
27 0.31
28 0.24
29 0.21
30 0.18
31 0.19
32 0.16
33 0.12
34 0.16
35 0.17
36 0.17
37 0.19
38 0.19
39 0.24
40 0.25
41 0.25
42 0.25
43 0.25
44 0.25
45 0.23
46 0.22
47 0.15
48 0.13
49 0.09
50 0.06
51 0.05
52 0.05
53 0.05
54 0.04
55 0.06
56 0.07
57 0.09
58 0.15
59 0.15
60 0.17
61 0.22