Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5WWW9

Protein Details
Accession A0A5N5WWW9    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
12-34IMNHTSRTRKLKQRQNKEHQSLIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029756  MTH1187/YkoF-like  
IPR002767  Thiamine_BP  
Pfam View protein in Pfam  
PF01910  Thiamine_BP  
Amino Acid Sequences MNTYIRSGLWLIMNHTSRTRKLKQRQNKEHQSLIDQAEGTWDQVSQVIGYAHTLIHQEGIPRIQTDIRITTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.32
3 0.34
4 0.35
5 0.42
6 0.48
7 0.51
8 0.58
9 0.67
10 0.72
11 0.8
12 0.85
13 0.88
14 0.9
15 0.85
16 0.8
17 0.7
18 0.62
19 0.55
20 0.46
21 0.36
22 0.25
23 0.2
24 0.17
25 0.16
26 0.13
27 0.09
28 0.07
29 0.06
30 0.07
31 0.07
32 0.05
33 0.06
34 0.06
35 0.06
36 0.07
37 0.07
38 0.06
39 0.07
40 0.08
41 0.07
42 0.08
43 0.09
44 0.1
45 0.12
46 0.14
47 0.15
48 0.15
49 0.17
50 0.17
51 0.19
52 0.22