Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UMW5

Protein Details
Accession A0A179UMW5    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
42-69AGQVKRLTCFQRRRARQRLSPRQDQSRLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9.5, cyto_nucl 8.5, pero 7, cyto 6.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036188  FAD/NAD-bd_sf  
Amino Acid Sequences MGDFRGTLCHTAAWPVDLDVRDKRVGLIGTGFTGKQVITAIAGQVKRLTCFQRRRARQRLSPRQDQSRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.16
4 0.15
5 0.19
6 0.18
7 0.21
8 0.2
9 0.2
10 0.19
11 0.18
12 0.18
13 0.15
14 0.14
15 0.11
16 0.11
17 0.11
18 0.11
19 0.08
20 0.08
21 0.07
22 0.06
23 0.06
24 0.05
25 0.05
26 0.05
27 0.06
28 0.1
29 0.1
30 0.1
31 0.13
32 0.13
33 0.14
34 0.18
35 0.23
36 0.28
37 0.37
38 0.47
39 0.55
40 0.65
41 0.73
42 0.8
43 0.84
44 0.85
45 0.87
46 0.89
47 0.87
48 0.87
49 0.85