Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5WKK3

Protein Details
Accession A0A5N5WKK3    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
7-46EEKAQSKSMGKEKRKPVRRDPEKRRQQNIRAQREKLREKLBasic
NLS Segment(s)
PositionSequence
13-43KSMGKEKRKPVRRDPEKRRQQNIRAQREKLR
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021833  DUF3425  
Pfam View protein in Pfam  
PF11905  DUF3425  
Amino Acid Sequences MPRDTIEEKAQSKSMGKEKRKPVRRDPEKRRQQNIRAQREKLREKLGNLETLAVSLAQRSPTTGTIQSESIPGYDVSDISISSLSTATSKDCQHLLRQSDHTTSELNIWDSTAYLTPSDNTLSSVSIWDSTIWDYSTQLSHSDISPSTPAISDSTKQLPPSESPLSAPSVWVPPTHIDPSILIHNKHKDGRDRCWTTTTVECDCSIPHFQIQTLGPGPYSCTEVRILRIGPIAPVPDPYASHLRLETICTLAAMDTLRMHIGITEEMMCVEESPSPFYRSIRASADNTVKEDIICTVQRIFKTLKPDLRPSSEQITVEHPPYIDVLPFRTLRKNLILHQQEVDEDEFLRDAVTGLVCWGGAGFGRKDRDVSTRYASTGTPWDNRSWEAKVWFLKKYWSLLGGEEGELVQQSEWWRSIRGEDPLDIEALA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.48
3 0.55
4 0.61
5 0.7
6 0.78
7 0.84
8 0.85
9 0.87
10 0.88
11 0.9
12 0.92
13 0.92
14 0.92
15 0.93
16 0.94
17 0.94
18 0.93
19 0.91
20 0.91
21 0.91
22 0.91
23 0.88
24 0.84
25 0.83
26 0.82
27 0.81
28 0.77
29 0.76
30 0.69
31 0.63
32 0.67
33 0.62
34 0.56
35 0.49
36 0.44
37 0.34
38 0.29
39 0.27
40 0.17
41 0.14
42 0.1
43 0.12
44 0.11
45 0.11
46 0.13
47 0.15
48 0.16
49 0.2
50 0.23
51 0.23
52 0.24
53 0.25
54 0.24
55 0.23
56 0.21
57 0.17
58 0.15
59 0.12
60 0.11
61 0.11
62 0.1
63 0.1
64 0.09
65 0.09
66 0.09
67 0.09
68 0.07
69 0.07
70 0.08
71 0.07
72 0.07
73 0.08
74 0.1
75 0.14
76 0.16
77 0.17
78 0.21
79 0.22
80 0.28
81 0.34
82 0.36
83 0.38
84 0.41
85 0.43
86 0.42
87 0.42
88 0.37
89 0.31
90 0.27
91 0.24
92 0.22
93 0.19
94 0.16
95 0.15
96 0.13
97 0.12
98 0.13
99 0.11
100 0.09
101 0.08
102 0.09
103 0.09
104 0.1
105 0.11
106 0.1
107 0.11
108 0.11
109 0.11
110 0.11
111 0.11
112 0.1
113 0.1
114 0.1
115 0.09
116 0.09
117 0.09
118 0.1
119 0.1
120 0.1
121 0.09
122 0.1
123 0.11
124 0.11
125 0.1
126 0.11
127 0.11
128 0.11
129 0.13
130 0.12
131 0.13
132 0.13
133 0.12
134 0.11
135 0.11
136 0.11
137 0.1
138 0.12
139 0.12
140 0.15
141 0.19
142 0.2
143 0.21
144 0.21
145 0.22
146 0.21
147 0.27
148 0.26
149 0.21
150 0.21
151 0.22
152 0.23
153 0.21
154 0.2
155 0.14
156 0.14
157 0.14
158 0.13
159 0.13
160 0.12
161 0.15
162 0.17
163 0.16
164 0.14
165 0.13
166 0.15
167 0.21
168 0.23
169 0.2
170 0.24
171 0.27
172 0.31
173 0.34
174 0.36
175 0.38
176 0.4
177 0.46
178 0.51
179 0.53
180 0.5
181 0.5
182 0.47
183 0.41
184 0.4
185 0.37
186 0.28
187 0.24
188 0.23
189 0.2
190 0.19
191 0.19
192 0.16
193 0.12
194 0.12
195 0.11
196 0.11
197 0.14
198 0.14
199 0.14
200 0.13
201 0.13
202 0.11
203 0.11
204 0.12
205 0.09
206 0.12
207 0.1
208 0.1
209 0.12
210 0.13
211 0.14
212 0.16
213 0.15
214 0.13
215 0.14
216 0.13
217 0.11
218 0.11
219 0.11
220 0.09
221 0.1
222 0.1
223 0.09
224 0.09
225 0.12
226 0.15
227 0.15
228 0.16
229 0.15
230 0.15
231 0.15
232 0.17
233 0.15
234 0.11
235 0.1
236 0.09
237 0.09
238 0.07
239 0.08
240 0.06
241 0.06
242 0.05
243 0.06
244 0.06
245 0.06
246 0.06
247 0.05
248 0.06
249 0.06
250 0.06
251 0.06
252 0.06
253 0.06
254 0.07
255 0.06
256 0.06
257 0.06
258 0.08
259 0.08
260 0.12
261 0.13
262 0.15
263 0.16
264 0.17
265 0.2
266 0.21
267 0.24
268 0.23
269 0.26
270 0.25
271 0.3
272 0.36
273 0.33
274 0.33
275 0.3
276 0.27
277 0.22
278 0.21
279 0.16
280 0.14
281 0.13
282 0.12
283 0.14
284 0.17
285 0.18
286 0.2
287 0.22
288 0.22
289 0.29
290 0.35
291 0.39
292 0.41
293 0.49
294 0.51
295 0.55
296 0.55
297 0.51
298 0.49
299 0.45
300 0.41
301 0.35
302 0.35
303 0.3
304 0.28
305 0.26
306 0.2
307 0.17
308 0.18
309 0.17
310 0.14
311 0.12
312 0.13
313 0.16
314 0.19
315 0.21
316 0.26
317 0.27
318 0.29
319 0.35
320 0.37
321 0.37
322 0.45
323 0.47
324 0.43
325 0.43
326 0.39
327 0.33
328 0.31
329 0.28
330 0.18
331 0.14
332 0.13
333 0.11
334 0.1
335 0.1
336 0.07
337 0.06
338 0.07
339 0.07
340 0.06
341 0.06
342 0.06
343 0.06
344 0.06
345 0.05
346 0.04
347 0.06
348 0.09
349 0.11
350 0.16
351 0.2
352 0.21
353 0.22
354 0.25
355 0.31
356 0.3
357 0.34
358 0.35
359 0.34
360 0.35
361 0.35
362 0.32
363 0.28
364 0.33
365 0.33
366 0.32
367 0.32
368 0.34
369 0.35
370 0.37
371 0.39
372 0.35
373 0.35
374 0.32
375 0.36
376 0.41
377 0.43
378 0.44
379 0.41
380 0.44
381 0.43
382 0.44
383 0.41
384 0.37
385 0.34
386 0.32
387 0.35
388 0.3
389 0.26
390 0.22
391 0.19
392 0.15
393 0.14
394 0.13
395 0.08
396 0.09
397 0.11
398 0.14
399 0.17
400 0.18
401 0.21
402 0.21
403 0.26
404 0.29
405 0.35
406 0.34
407 0.34
408 0.36
409 0.34