Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5WYV8

Protein Details
Accession A0A5N5WYV8    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
387-427GATARRLTRIRPPRRRIPGSAPAARWRARRKANFGPPERVFHydrophilic
NLS Segment(s)
PositionSequence
391-420RRLTRIRPPRRRIPGSAPAARWRARRKANF
Subcellular Location(s) nucl 13.5, cyto_nucl 9, cysk 7, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MGPSTLDSLPIEVIEIMVTLIDFRDSCNLRLASRTISAKSSNSTFRTHFSSKKIRVTKENLRQLVEDTQPGRLGCYIQNLTLIDLPESSGVEKVDRLGAEESDYNFGAVEPDTAAAELLSQVMNNLRLNTARGCLSSLTLMIEVSDTDYWTPIWKAASNLFQITTLALGESKIPIQAMDIFSDVSRCSLACGLIMKMLENIDLSPSLKGAKRISLCVSHNQRQGRGDNDPPMESLSVAESHLKAICQFLSIPSQLEDLQLYWYKLDSFEVTAAQEEEQQIFTRIIQSCQFPFMARFTLKGVRTSEAELLSFLHPVQLTALCLEEVYLTPGSFRAIFKYLAAHKERLKFLHFDNLWDKKLIHFDYAGEPPFPGFPKENLGPITITRTGATARRLTRIRPPRRRIPGSAPAARWRARRKANFGPPERVFPPGLRLMMGRAIARQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.05
5 0.05
6 0.04
7 0.05
8 0.06
9 0.06
10 0.07
11 0.16
12 0.18
13 0.2
14 0.28
15 0.29
16 0.29
17 0.33
18 0.34
19 0.3
20 0.34
21 0.37
22 0.31
23 0.33
24 0.36
25 0.34
26 0.36
27 0.37
28 0.38
29 0.37
30 0.4
31 0.38
32 0.38
33 0.44
34 0.46
35 0.46
36 0.48
37 0.55
38 0.58
39 0.66
40 0.71
41 0.68
42 0.72
43 0.75
44 0.77
45 0.76
46 0.79
47 0.73
48 0.67
49 0.62
50 0.56
51 0.54
52 0.45
53 0.41
54 0.31
55 0.3
56 0.3
57 0.29
58 0.27
59 0.21
60 0.21
61 0.17
62 0.24
63 0.23
64 0.21
65 0.24
66 0.23
67 0.24
68 0.24
69 0.23
70 0.15
71 0.14
72 0.14
73 0.11
74 0.11
75 0.1
76 0.09
77 0.09
78 0.1
79 0.1
80 0.1
81 0.13
82 0.12
83 0.14
84 0.14
85 0.14
86 0.16
87 0.18
88 0.18
89 0.17
90 0.17
91 0.15
92 0.13
93 0.13
94 0.11
95 0.09
96 0.08
97 0.06
98 0.06
99 0.07
100 0.07
101 0.07
102 0.05
103 0.05
104 0.05
105 0.05
106 0.04
107 0.04
108 0.05
109 0.07
110 0.1
111 0.1
112 0.11
113 0.11
114 0.12
115 0.15
116 0.15
117 0.16
118 0.14
119 0.14
120 0.14
121 0.14
122 0.14
123 0.12
124 0.11
125 0.1
126 0.09
127 0.08
128 0.07
129 0.07
130 0.06
131 0.07
132 0.07
133 0.06
134 0.06
135 0.07
136 0.07
137 0.09
138 0.09
139 0.09
140 0.1
141 0.11
142 0.12
143 0.15
144 0.2
145 0.2
146 0.2
147 0.19
148 0.18
149 0.17
150 0.15
151 0.12
152 0.07
153 0.06
154 0.05
155 0.05
156 0.05
157 0.05
158 0.06
159 0.06
160 0.06
161 0.05
162 0.06
163 0.09
164 0.1
165 0.1
166 0.1
167 0.1
168 0.1
169 0.11
170 0.1
171 0.07
172 0.06
173 0.05
174 0.06
175 0.07
176 0.07
177 0.07
178 0.08
179 0.08
180 0.09
181 0.09
182 0.09
183 0.08
184 0.08
185 0.08
186 0.07
187 0.06
188 0.05
189 0.06
190 0.06
191 0.06
192 0.06
193 0.08
194 0.09
195 0.13
196 0.13
197 0.18
198 0.18
199 0.2
200 0.22
201 0.25
202 0.26
203 0.31
204 0.37
205 0.38
206 0.42
207 0.42
208 0.42
209 0.4
210 0.4
211 0.35
212 0.31
213 0.28
214 0.28
215 0.28
216 0.26
217 0.23
218 0.22
219 0.19
220 0.15
221 0.12
222 0.08
223 0.07
224 0.07
225 0.08
226 0.07
227 0.08
228 0.08
229 0.08
230 0.08
231 0.08
232 0.08
233 0.07
234 0.07
235 0.08
236 0.11
237 0.11
238 0.11
239 0.11
240 0.12
241 0.12
242 0.12
243 0.11
244 0.08
245 0.1
246 0.11
247 0.11
248 0.1
249 0.1
250 0.1
251 0.1
252 0.1
253 0.09
254 0.08
255 0.08
256 0.09
257 0.09
258 0.09
259 0.1
260 0.09
261 0.1
262 0.09
263 0.09
264 0.1
265 0.1
266 0.11
267 0.11
268 0.11
269 0.15
270 0.15
271 0.16
272 0.17
273 0.19
274 0.19
275 0.2
276 0.21
277 0.15
278 0.16
279 0.16
280 0.19
281 0.16
282 0.17
283 0.18
284 0.24
285 0.25
286 0.28
287 0.28
288 0.25
289 0.26
290 0.28
291 0.27
292 0.22
293 0.21
294 0.16
295 0.16
296 0.15
297 0.14
298 0.11
299 0.1
300 0.09
301 0.09
302 0.11
303 0.09
304 0.09
305 0.09
306 0.1
307 0.08
308 0.08
309 0.08
310 0.07
311 0.06
312 0.09
313 0.09
314 0.08
315 0.08
316 0.09
317 0.1
318 0.11
319 0.12
320 0.12
321 0.14
322 0.15
323 0.16
324 0.22
325 0.25
326 0.31
327 0.34
328 0.35
329 0.39
330 0.45
331 0.48
332 0.45
333 0.44
334 0.39
335 0.37
336 0.43
337 0.37
338 0.36
339 0.41
340 0.44
341 0.42
342 0.41
343 0.39
344 0.32
345 0.39
346 0.36
347 0.29
348 0.24
349 0.24
350 0.27
351 0.32
352 0.31
353 0.23
354 0.21
355 0.2
356 0.22
357 0.21
358 0.2
359 0.18
360 0.18
361 0.25
362 0.27
363 0.3
364 0.29
365 0.29
366 0.26
367 0.25
368 0.29
369 0.24
370 0.23
371 0.19
372 0.19
373 0.2
374 0.23
375 0.27
376 0.28
377 0.29
378 0.36
379 0.38
380 0.41
381 0.49
382 0.56
383 0.62
384 0.66
385 0.72
386 0.75
387 0.83
388 0.87
389 0.83
390 0.82
391 0.81
392 0.79
393 0.78
394 0.72
395 0.69
396 0.69
397 0.66
398 0.65
399 0.64
400 0.65
401 0.67
402 0.72
403 0.73
404 0.77
405 0.82
406 0.84
407 0.83
408 0.83
409 0.75
410 0.73
411 0.66
412 0.59
413 0.51
414 0.41
415 0.41
416 0.37
417 0.35
418 0.29
419 0.28
420 0.27
421 0.29
422 0.3