Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5XCS4

Protein Details
Accession A0A5N5XCS4    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
57-78LDKPFPPGRKGERRRPANGRYLBasic
NLS Segment(s)
PositionSequence
63-73PGRKGERRRPA
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018608  Gti1/Pac2  
Pfam View protein in Pfam  
PF09729  Gti1_Pac2  
Amino Acid Sequences MLPHGPYQSHDREKDHPARSGSVLVYRSSSSGITRWTDGWAWRPDRNLGNFLVYRELDKPFPPGRKGERRRPANGRYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.59
3 0.56
4 0.5
5 0.49
6 0.46
7 0.43
8 0.35
9 0.3
10 0.27
11 0.22
12 0.21
13 0.18
14 0.17
15 0.15
16 0.15
17 0.11
18 0.11
19 0.13
20 0.13
21 0.13
22 0.13
23 0.14
24 0.14
25 0.15
26 0.19
27 0.22
28 0.24
29 0.25
30 0.26
31 0.28
32 0.32
33 0.33
34 0.3
35 0.25
36 0.26
37 0.25
38 0.24
39 0.24
40 0.2
41 0.19
42 0.19
43 0.21
44 0.18
45 0.18
46 0.24
47 0.26
48 0.32
49 0.33
50 0.39
51 0.46
52 0.56
53 0.64
54 0.69
55 0.73
56 0.75
57 0.81
58 0.83